KEGG   Sus scrofa (pig): 100515997
Entry
100515997         CDS       T01009                                 

Gene name
SGTA
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat-containing protein alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100515997 (SGTA)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100515997 (SGTA)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_8 TPR_2 TPR_11 TPR_17 TPR_7 TPR_14 TPR_10 TPR_16 TPR_12 TPR_19 TPR_9 TOM20_plant NARP1 TPR_6 BTAD DUF627 STI1
Other DBs
NCBI-GeneID: 100515997
NCBI-ProteinID: NP_001231321
Ensembl: ENSSSCG00000013467
UniProt: A0A4X1VS62 A0A287A1V6
Position
2
AA seq 313 aa
MDNKKRLAYAIIRFLHDQLRHGGLSPDAQESLEVAIQCLETAFGVTVEDSDLALPQTLSE
IFEAAASGKEVPQDLRSPQQTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPSNAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPSYSKAYGRMGLALSSLNKHTEAVA
YYRKALELDPDNETYKSNLKVAELRLREAPSPTGGVGSFDIAGLLNNPSFMSMASNLMNN
PQVQQLMSGMISGGHNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
SRTPSASNDDQQE
NT seq 942 nt   +upstreamnt  +downstreamnt
atggacaacaagaagcgcctggcctatgccatcatccgcttcctgcatgaccagctccgg
cacggggggctttcacccgacgcccaggaaagcttggaagttgcaatccagtgcctggag
accgcttttggggtgacggtggaggatagcgacctcgcactccctcagactctctcagag
atatttgaagcagctgcctcaggcaaggaagtgccgcaggatctgaggagcccccagcag
accccaccttcagaggaggactccgccgaggcagagcgcctcaaaactgaaggaaatgaa
cagatgaaagtagaaaactttgaggccgccgtgcacttctacgggaaagccatcgagctg
aacccctccaatgccgtctacttctgtaacagagctgcagcctacagcaaactgggcaac
tacgcaggcgccgtacaggactgtgagcgagccatctgcatagacccgtcctatagcaag
gcctacggcaggatgggcctggcactgtccagcctgaacaagcacacagaggccgtggcc
tactataggaaggccttggagctggaccccgacaatgagacctacaagtccaacctcaag
gtcgcagagctgaggctgagagaggcgcccagccctacgggaggtgttggcagctttgac
atcgcaggcctgctgaacaacccgagctttatgagcatggcatcaaatctaatgaataat
ccccaggttcaacagctcatgtctggcatgatttcgggtggccacaaccccctggggact
ccgggcaccagtccctcgcagaacgacctggccagtctcatccaggcgggccagcagttc
gctcagcagatgcagcagcagaacccagagttgatagaacagctacgaagtcagatccgc
agtcggacccccagtgccagcaacgatgaccagcaggagtga

DBGET integrated database retrieval system