KEGG   Sus scrofa (pig): 100516456
Entry
100516456         CDS       T01009                                 

Gene name
TWIST1
Definition
(RefSeq) twist-related protein 1
  KO
K09069  twist
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100516456 (TWIST1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100516456 (TWIST1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    100516456 (TWIST1)
SSDB
Motif
Pfam: HLH HTH_51 DUF773 GDH_N
Other DBs
NCBI-GeneID: 100516456
NCBI-ProteinID: XP_003130240
UniProt: A0A4X1TEI0
Position
9
AA seq 202 aa
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGSSGPGGAAGGGV
GGGEEPGSPAQGKRGKKSAGCGGGGGGAGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH
NT seq 609 nt   +upstreamnt  +downstreamnt
atgatgcaggacgtgtccagctcgccagtctcgccggccgacgacagcctgagcaacagc
gaggaggagccggaccggcagcagccgccaagcggcaagcgcggggggcgcaagcggcgc
agcagccggcgcagcgcggggggcagctcggggcccggcggggccgcgggcgggggcgtc
ggaggcggcgaggagcctggcagcccggcccaaggcaagcgcggcaagaagtctgcgggc
tgcggcggcggcggcggcggcgcgggaggaggcggtagcagcagcggcggcgggagtccg
cagtcctacgaggagctgcagacacagcgggtcatggccaacgtgcgggagcgccagcgc
acacagtcgctgaatgaggcgttcgccgcactgaggaagatcatccccacgctgccctca
gacaagctgagcaagatccagaccctcaagttggcggccaggtacatcgacttcctctac
caggtcctacagagtgacgagctggactccaagatggccagttgcagctatgtggcccac
gagcggctcagctacgccttctcggtgtggaggatggagggggcctggtccatgtccgcg
tcccactag

DBGET integrated database retrieval system