KEGG   Sus scrofa (pig): 100516535Help
Entry
100516535         CDS       T01009                                 

Gene name
SNX30
Definition
(RefSeq) sorting nexin-30
  KO
K17921  sorting nexin-7/30
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100516535 (SNX30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 BAR BAR_3_WASP_bdg
Motif
Other DBs
NCBI-GeneID: 100516535
NCBI-ProteinID: XP_003122129
Ensembl: ENSSSCG00000005471
UniProt: A0A287A447
Position
1
AA seq 437 aa AA seqDB search
MSGRPPKALPSTGPHSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGG
TPAGTASPASSSSLLNRLQLDDDIDGETRDLFVTVDDPKKHVCTMETYITYRITTKSTRV
EFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKAL
DKFLKRITDHPVLSFNEHFNVFLTAKDLNVYKKQGMALLSRVGESVKHVTGGYKLRSRPL
EFAAIGEYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEG
VSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAEYEAKLEAVAL
RKEERPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCL
MAWESIIPLLQEKQEAK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaggccccccaaggccctgccgtccacggggccccactccctgcgcgacatg
ccgcacccgctggccggctccagcagcgaggaggccgtgggcggcgacagcacgcccagt
ccggacctgctgatggcccgcagcttcggcgacaaggacctcattttgcccaacggtggt
actccagcaggcactgcgagtccggcttcttcgtcttcccttctcaacagacttcagctt
gatgatgacattgatggtgagactagagacctctttgtcacggttgatgatcccaagaag
catgtgtgcacgatggagacctacatcacgtacaggatcaccaccaagagtacacgggtg
gagtttgacctgccagaatattctgttcgacgaagataccaggattttgactggttgagg
aacaaactggaagaatcccagcccactcatctcattcccccacttcctgagaaatttgtg
gtgaaaggtgttgtggatcgattttcagaagaatttgtggagaccagaagaaaagctttg
gataaattcctgaaaagaattacagatcatcctgtgctctctttcaacgaacactttaat
gttttccttactgccaaggacctgaacgtgtacaagaagcaggggatggcgttgctgagt
cgggtgggcgagtcggtcaagcatgtcacgggaggctacaagctgaggagccggccgctg
gagtttgcagccataggcgagtacttagacacgttcgcgctcaaactgggaaccatcgat
cggatagcccagcggatcatcaaggaagaaatagagtaccttgtagagctgagagaatac
gggcctgtgtactccacgtggagcgcgttagagggggagctggccgagcccctggagggt
gtgtccgcttgcatcggcaactgctctacagccttggaagagctgacagacgacatgaca
gaagactttctcccagtgctcagggaatatattttatactctgactccatgaagagtgtg
ctgaagaagagggaccaagtgcaagcggagtatgaagccaaactggaggccgtggcgctg
aggaaggaagaacggcccaaggtcccggcggatgttgagaaatgtcaggatcggatggag
tgtttcaatgctgacctgaaagccgacatggagaggtggcaaaacaacaagaggcaggac
ttccggcagctgctcatgggaatggccgataagaacatccagtattacgagaagtgcctc
atggcgtgggagtcgattatcccactgctgcaggagaagcaagaggccaagtaa

DBGET integrated database retrieval system