KEGG   Sus scrofa (pig): 100517117Help
Entry
100517117         CDS       T01009                                 

Gene name
CDC42EP4
Definition
(RefSeq) cdc42 effector protein 4
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: BORG_CEP PBD
Motif
Other DBs
NCBI-GeneID: 100517117
NCBI-ProteinID: XP_003131291
Ensembl: ENSSSCG00000017245
UniProt: A0A4X1SKS7 F1RV35
Position
12
AA seq 357 aa AA seqDB search
MPILKQLVSSSVHSKRRSRVDLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEL
DSESMDEQASSSSSKRSLLSRKFRGSKRSQSVTRGDREQRDMLGSLRDSALFVKNAMSLP
QLNEKEAAEKGSSKLPKSLSSSPVKKASGEGSPEEAGVEEAVPRRNGAAAPHSPDPLLDE
QAFGDLTDLPIVPKASFGLKHAESIMSFHIDLGPSMLGDVLSIMDKEEWEAQEEDGGYHG
DDDPAGSPSQAPPSASAPPLARPEGEGGPDLPPLPSRALQDEGWAAAAAAAPSPGSARSE
GSHTTRDSSSLSSCTSGVLEERSPAFRGPDRARATLPRQPDTEFSFMDEEEEDEIRV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcctcaagcagctggtgtccagctccgtacactccaagcgtcgctcccgagtg
gacctcacggctgagatgatcagtgccccgctgggtgacttccgccacaccatgcacgtg
ggccgggcgggggacgcctttggggacacttcctttctcaacagcaaggccggggagctg
gacagtgagtccatggacgagcaggcctcctcctcgtcctctaaacgcagcctcctctcc
cggaagttccggggcagcaagcggtcgcagtcagtgaccaggggggaccgggagcagagg
gacatgctgggctccctgcgggactcggccctcttcgtcaagaatgccatgtccctgccc
cagctgaacgagaaggaggccgcagagaagggctccagcaagctccccaagagcctgtcg
tccagccccgtgaagaaggccagcggggagggcagcccggaggaggcgggcgtggaggag
gccgtgccccggcggaacggggctgccgccccccactccccagaccccctcctcgacgag
caggccttcggggacctgacggatctgcccatcgtgcccaaggccagcttcgggctgaag
cacgccgagtccatcatgtctttccacatcgacctggggccctccatgctgggcgatgtc
ctcagcatcatggacaaggaggagtgggaagcccaggaggaggatggcggttaccatggt
gacgatgacccagcaggcagcccctcccaggctccaccttcggcgtcagcccctcccctg
gcaaggccggaaggcgaggggggcccggacttgcccccgctgccctcccgcgccctgcag
gatgagggctgggcggcggcggcggcggctgcccccagccccggctcggcccgtagtgag
ggcagccacaccacgcgggacagcagctccctgtccagctgcacctcgggtgtcctggag
gagcgcagccccgccttccgcgggccggaccgggcccgggccaccctcccgaggcagcct
gacaccgagttctccttcatggatgaggaggaagaggatgagatccgagtgtga

DBGET integrated database retrieval system