KEGG   Sus scrofa (pig): 100517187
Entry
100517187         CDS       T01009                                 

Gene name
BCL6B
Definition
(RefSeq) B-cell CLL/lymphoma 6 member B protein
  KO
K22648  B-cell CLL/lymphoma 6 member B protein
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100517187 (BCL6B)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100517187 (BCL6B)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met Zn-ribbon_8 zf-C2HE zf-C2H2_6
Other DBs
NCBI-GeneID: 100517187
NCBI-ProteinID: XP_003131975
Ensembl: ENSSSCG00000017927
Position
12
AA seq 483 aa
MGSTATPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDMLSLPGGPEAGGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG
PPSPGSPDPKACNWKKYKFIVLNSQASQAGSLGGERSSGQLCSQAQLPSADEASSSSSSS
SSSSSSGSEEGPIPGPQSRLSPTAATGQFKCGAPVNTPLLLAPRAPETTGPPSGRARPLP
GSEFFSCQNCEAVAGCSSGLDPLAPGDEDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPY
HCSICGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPT
CGTRFRHLQTLKSHVRIHTGEKPYHCDPCSLHFRHKSQLRLHLRQKHGAATNTKVHYHIL
GGP
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgggttccaccgctaccccggagggagcgctgggctacgtccgcgagttcactcgccac
tcctccgacgtgctcggcaacctgaatgagctgcgcctgcgcgggatcctcactgacgtc
acgctactggttggcgggcaacccctgcgagcgcacaaggcggttcttattgcctgcagt
ggcttcttctattcaattttccgaggccgtgcaggagtgggggtagacatgctctccctg
cctgggggtccggaagctggaggcttcgctcctcttctggacttcatgtacacctcgcgc
ctacgcctctctccggctacggcgccagcggtcctggcagctgccacctacttgcagatg
gaacacgtggtccaggcatgccaccgcttcatccaggccagctatgaacctctgggcatc
tccctgcgacccctggaggcagaaccccccacgcccccaacggcccctcctccaggcagt
cccaggcgctccgaaggacacccagacccacctactgagtctcgcagctgcagtcaaggg
ccccccagtccaggcagcccagaccccaaggcctgcaactggaaaaagtacaagttcatc
gtgctaaactctcaggcctcccaagcagggagcctaggcggggagagaagttctggtcaa
ctttgctcccaagctcagctccccagtgcagatgaggcttccagcagcagcagcagcagc
agcagcagcagcagcagcggcagcgaagaaggacccattcctggcccccagagcaggctc
tctcccactgctgccactggacagttcaaatgtggggctccagtcaataccccccttctc
ctcgcaccccgggctccagagaccactgggccaccctctgggcgggcccgtccactacca
ggaagtgaatttttcagctgccagaactgtgaggctgtggctgggtgctcatcggggctg
gaccccttggctcctggggatgaggacaagccctacaagtgtcagctctgccggtctgcc
ttccgctataagggcaacttggccagtcaccgcactgtgcacacaggggaaaagccctac
cactgctccatctgcggagcccgcttcaaccggcctgctaacctgaaaacgcacagccgc
atccattcgggagagaagccctataagtgtgagacgtgtggctcgcgctttgtccaggtg
gcgcatctgcgggcccacgtgctgatccacacgggggaaaagccctatccttgccccacc
tgcgggactcgcttccgccacctacagaccctcaagagccacgttcgcatccacacggga
gagaagccttaccactgcgacccctgcagcctgcatttccggcacaagagtcaactccgg
ctgcatctgcgccagaaacacggagctgctaccaacaccaaagtgcattaccacattctg
ggggggccctag

DBGET integrated database retrieval system