KEGG   Sus scrofa (pig): 100517251Help
Entry
100517251         CDS       T01009                                 

Gene name
TTC26
Definition
(RefSeq) intraflagellar transport protein 56 isoform X1
  KO
K19685  intraflagellar transport protein 56
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100517251 (TTC26)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    100517251 (TTC26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_19 ANAPC3 TPR_2 TPR_14 TPR_8 TPR_16 TPR_1 TPR_9 TPR_17 TPR_12 TPR_11 Coatomer_E TPR_6
Motif
Other DBs
NCBI-GeneID: 100517251
NCBI-ProteinID: XP_003134668
Ensembl: ENSSSCG00000016511
UniProt: A0A287ARA1
Position
18
AA seq 554 aa AA seqDB search
MMLSRAKPAVGGDLPHTDRRKKKGRKIPKLEELLSQRDFTGAITLLEFKRHVGEQEEDTN
LWIGYCAFHLGDYKRALEEYENATKEENCNPEVWVNLACTYFFLGMYKQAEAAGFKAPKS
RLQNRLLFHLAHKFNDEKKLMNFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLD
NREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGKAAEA
ELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDD
VQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIP
GRQCMASCFFLLKQFDDVLIYLNSFKNYFYNDDIFNFNYAQAKAATGSTSEGEEIFLLIQ
SEKLKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYRMGQFYYS
AKAFDVLERLDPNPEYWEGKRGACVGIFQMILAGREPKETLREVLHLLRSTGNSQVEYII
RIMKKWAKENRVPV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgatgctttcaagagccaaacctgctgtaggtggggacctaccgcacactgacagaaga
aagaagaaaggtaggaagattccaaaactagaggagctactttcacaaagagatttcact
ggagctattactctgttggagttcaaacgtcatgttggggaacaagaagaggatactaat
ttgtggattggatactgtgcttttcacctgggtgactacaagagagctttggaggaatat
gaaaatgcgacaaaagaggaaaattgcaatcctgaagtctgggtgaacctagcctgtacc
tactttttccttggaatgtataaacaagctgaagcagctggatttaaagctccaaaaagc
cgacttcaaaaccgcctcctcttccacttggctcacaagtttaatgatgagaagaaattg
atgaactttcatcagaatcttcaggatgtcaccgaagatcagctcagtttggcctcgatc
cactatatgcgatctcactaccaagaagctattgatatttataagcggattctgctagac
aacagggagtaccttgccctcaacgtttatgtggccctgtgttactacaagttggattac
tacgatgtgtctcaagaagttctggctgtttatcttcagcaaattcctgatagtaccatc
gcactcaaccttaaggcctgcaatcattttcgcctttacaacggcaaagcagccgaggca
gaactcaaaagcttgatggacaacgcttcttcgtcctttgaatttgctaaggagctcatc
aggcacaatctggttgttttccgaggaggcgaaggggctttgcaagttttgcctcccctg
gtcgatgtcatccctgaagctaggctaaacttagtgatttactaccttcgtcaagatgat
gtacaggaagcttataacttaattaaggatctggaacctactactcctcaggaatacatc
ctcaaaggagtggtcaatgcagcccttggccaggaaatgggttcaagggaccatatgaaa
attgcccagcagttcttccagttggtgggaggatcagctagtgaatgtgatacaatacca
gggaggcagtgcatggcttcctgtttcttcctgcttaagcaatttgatgatgtcttgatt
tacctcaactcatttaagaattacttttataatgatgacatctttaactttaattatgcc
caagccaaagctgcaactggcagtaccagtgagggtgaagagattttccttttaatccaa
agtgagaagttgaaaaatgactacatttacctcagttggttggctcggtgctacattatg
aataagaaaccaagactagcctgggaactttatctcaagatggaaacctctggcgaatcc
tttagcctcttacagctcattgccaatgactgctacaggatgggccagttttactattca
gccaaagcctttgacgtcttagagaggctggatcccaaccctgaatattgggaaggcaag
aggggtgcctgtgtaggcatattccagatgatcttagctggaagagaacccaaagagacc
cttcgagaagtgctccacttactgagaagcacgggtaacagccaagtggagtacatcatc
cggatcatgaagaaatgggccaaagaaaaccgggtgcccgtctaa

DBGET integrated database retrieval system