KEGG   Sus scrofa (pig): 100517354
Entry
100517354         CDS       T01009                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X2
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc00240  Pyrimidine metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100517354 (DCK)
   00240 Pyrimidine metabolism
    100517354 (DCK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100517354 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 CoaE DUF932
Other DBs
NCBI-GeneID: 100517354
NCBI-ProteinID: XP_003129122
Ensembl: ENSSSCG00000008942
UniProt: A0A4X1TA10 F1RUN9
Position
8
AA seq 260 aa
MATPPKRSCPSSPASSEGNRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQNEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHSSLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccccccaagaggagctgcccgtcttccccagccagctcagaggggaaccgc
atcaagaaaatttccattgaagggaacatcgctgcggggaagtcaacatttgtgaatatt
cttaaacaagtctgcgaggattgggaagtggttcctgaacctgttgccaggtggtgcaat
gttcagagtactcaaaatgaatttgaggaattgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcctatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcaatggcaagctcaaagatgcagag
aaacctgtattattctttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ctgtatgaatctgactgcatgaatgaaacagaatggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgcgcc
actccagagaaatgtttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatacttagagaagcttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaacgaa
gactttaaagacaaacacagcagtctggttgaaaaggtaaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system