KEGG   Sus scrofa (pig): 100517467
Entry
100517467         CDS       T01009                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100517467 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100517467 (ASIC1)
Ion channels [BR:ssc04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100517467 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 100517467
NCBI-ProteinID: XP_020947298
Ensembl: ENSSSCG00000000216
Position
5
AA seq 527 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKSGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRQLIYLPPPWGTCKAVTMDLDF
FDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYC
VCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIE
QKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSAD
KGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagtagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctcaagcgggctctctgggccctgtgcttcctgggctcgctggccgtgctgctgtgcgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcaccttccctgccgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtaccacgctggggagctgctggctctgctcaacaac
aggtatgagataccggacacacagatggcagatgaaaagcagctggagatactgcaggac
aaggccaacttccgcagcttcaagcccaagcccttcaacatgcgcgagttctatgaccgc
gcagggcacgacattcgagacatgctgctctcctgccacttccggggggaggtctgcagc
gccgaggacttcaaggtggtcttcacgcggtatggaaagtgctacacgttcaactcgggc
cgagatgggcgtccccggctgaagaccatgaagagtgggacgggcaatgggctggagatc
atgctggacatccagcaggacgagtacctgcccgtatggggggagaccgatgagacatcc
ttcgaagcaggcatcaaagtgcagatccacagtcaggacgaacctcccttcatcgaccag
ctgggctttggcgtagccccagggttccagacttttgtggcctgccaagagcagcggcag
ctcatctacctgcccccgccctggggcacctgcaaagctgttaccatggacttggatttc
ttcgactcctacagcattaccgcctgccgcatcgactgtgagacacgctacctggtggag
aactgtaactgccgcatggtgcacatgccaggggatgccccatactgcactccagagcag
tacaaggagtgtgcagaccctgctctggacttcctggtggagaaggaccaggagtactgt
gtgtgtgaaatgccctgcaatttgacccgctatggcaaggagctgtccatggtcaagatc
cccagcaaagcatcagccaagtacctggccaagaagttcaacaagtctgagcagtacata
ggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatcgag
cagaagaaggcctatgagattgcagggctcctgggtgacattggtggccagatggggctg
ttcatcggggccagcatcctcacggtgctggagctcttcgactacgcctacgaggtcatt
aaacacaaactgtgtcgccgcggcaagtgccagaaggaggccaaacggagcagcgcggac
aagggtgtggccctcagcctggatgacgtcaaaagacacaacccatgtgagagcctccgg
ggccatcctgctgggatgacgtacgctgccaacatcctacctcaccatccggcccgaggc
acttttgaggactttacctgctga

DBGET integrated database retrieval system