KEGG   Sus scrofa (pig): 100517586
Entry
100517586         CDS       T01009                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100517586 (RDH5)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100517586 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 100517586
NCBI-ProteinID: XP_003126302
Ensembl: ENSSSCG00000000362
Position
5
AA seq 318 aa
MWLPLLLGVLLWALLWLLRDRQSLPTSDAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSIQRAAKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWQTREDFQQVLNVNTLGPIGVTLALLPLLRQARGRVVNVSSVLGRLAANGGGYCVSKF
GVEAFSDSLRRDVAPFGIRVSIVEPGFFQTPITNPESLDNIIKTRWARLPPATQALYGEA
YLTKYLRLQHHFMNLLSDLDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVFTWILPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggagtcttgctctgggcactgctatggttgctcagggac
cggcagagcctgcccaccagcgatgcttttgtctttatcaccggctgcgactcgggcttc
ggacggcttttggcactgaggctggaccagagaggcttccgagtcctggccagctgcctg
accccctctggagccgaagacctacagcgtgtggcttcctcccgcctccacaccaccctg
ctggatgtcactgatccccaaagcatccagcgggcagccaagtgggtggaaacacatgtt
ggggaagcagggctttttggtctggtgaataatgccggcgtggctggcattatcgggccc
accccttggcagacacgggaggatttccagcaggtgctgaatgtgaacacgctgggtccc
atcggggtcacccttgccctgctgcccctgctgcggcaggcccggggccgggtagtcaac
gtcagcagtgtcctgggtcgcctggcagccaatggaggaggctactgcgtctccaagttt
ggcgtggaggccttctctgacagcctgaggcgggacgtggctccttttgggattcgagtc
tccatcgtggagcctggtttcttccaaacccctataacaaacccggaaagtttggacaac
atcataaagacccgctgggcacggctgcctccagccacacaggccctctatggggaggcc
tacctcaccaagtacctgagactgcagcatcatttcatgaacctgctctctgacctggac
ctgaccaaagtgagcaggtgcctggagcatgccctgactgcccgtcaccccagaacccgc
tacagcccaggctgggatgccaagctactttggctgccagcctcctacctgccagccagc
ctggtggatgctgtgttcacctggatcctccccaagcctgctcaggcagtctactga

DBGET integrated database retrieval system