KEGG   Sus scrofa (pig): 100517908
Entry
100517908         CDS       T01009                                 

Gene name
ZBTB37
Definition
(RefSeq) zinc finger and BTB domain-containing protein 37
  KO
K10509  zinc finger and BTB domain-containing protein 37
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100517908 (ZBTB37)
   04121 Ubiquitin system [BR:ssc04121]
    100517908 (ZBTB37)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100517908 (ZBTB37)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100517908 (ZBTB37)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3342 zf-met zf-C2H2_2 zf-C2H2_jaz zf-H2C2_5 BTB_2 zf-Di19
Other DBs
NCBI-GeneID: 100517908
NCBI-ProteinID: XP_005656776
Ensembl: ENSSSCG00000015494
UniProt: A0A4X1UGQ5 A0A480L9D6
Position
9
AA seq 503 aa
MEKGGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDH
MSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQ
ILEGIHFKINVAEVEAELSQTRTKHPEGPPESHRVTPNLNRSLSPRHNTPKGNRRGQVST
VLDIRELSPPEESTSPQIIEQSSDVESREPILRINRAGQWYVETGVADRGARSDDEVRVL
GAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSVGQENYSLGSSGAKVAR
PTSSEIDRFSPSGSVVPLTERHRARSESPGRMDEPKQPSSQVEESAMMGVSGYVEYLREQ
EVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHI
RKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRGQAEEES
PSQEETVASGETAPGSVSTTGPD
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggagaaaggtgggaacatacaactggagatacctgatttcagcaactcagtcctaagc
catctaaaccaactgcgcatgcagggacgtctctgtgacatcgtggtcaatgtgcaagga
caagcttttagggctcacaaagtggtactggcagccagctccccctatttccgagatcac
atgtccttgaatgagatgagtactgtctctatctcagtcatcaagaaccctactgttttc
gagcagctcctttctttctgttacacggggcgaatatgcctgcaactggcagatatcatc
agctacctgacagctgccagttttctgcaaatgcagcatattatagacaaatgtacacag
atcctggagggcattcatttcaaaattaatgtggctgaggttgaagctgaattaagtcaa
acgaggacaaagcatccagagggacctccagagtctcacagagttacaccaaatctgaac
cgctctcttagcccccgacataatactccaaagggaaaccggcgaggtcaggttagcacg
gtgctggatatcagggagctcagtcctcctgaggagtccaccagccctcagataattgag
cagagttctgacgtcgagagcagggagcccatcctgaggatcaaccgagcaggacagtgg
tatgtggagacgggagtagccgacagaggggcccggagtgatgatgaagttagagtcctt
ggagcagtacacatcaaaactgaaaatctagaagagtggcttgggcctgagaatcagcct
tccggagaagatgggagtagtgcagaggaagtcacagccatggtgattgacaccacaggc
catggttctgtaggacaggaaaactacagtttaggatcttcaggagccaaggtggctaga
ccaacaagcagtgaaattgacagatttagcccctctggcagtgttgttcctctgacggag
agacacagagcccgaagtgagtctcctgggagaatggatgagcctaagcaacccagctca
caggtagaagagtctgcaatgatgggagtaagtggctatgtggagtatctccgagagcag
gaagtatctgagcggtggttccggtacaaccctcgtctcacctgcatctactgcgccaaa
tctttcaatcagaagggaagcctggaccgccacatgcgcctgcacatgggaatcacacca
ttcgtctgccgcatgtgtggcaagaagtatacccggaaggatcagctggagtatcacatc
cgcaagcacacaggcaacaaaccttttcactgtcatgtttgtggcaaaagtttccccttc
caggccatcttgaatcagcactttcgcaaaaaccaccctggctgtatacccctggaggga
cctcatagcatctcccctgaaacaactgtcacgtctcgaggacaggccgaggaagagtct
ccttctcaagaagagacagttgcttctggggaaaccgccccgggctctgtttccactact
gggccagattga

DBGET integrated database retrieval system