KEGG   Sus scrofa (pig): 100519020
Entry
100519020         CDS       T01009                                 

Gene name
UBQLN4
Definition
(RefSeq) ubiquilin-4
  KO
K04523  ubiquilin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100519020 (UBQLN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100519020 (UBQLN4)
   03051 Proteasome [BR:ssc03051]
    100519020 (UBQLN4)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100519020 (UBQLN4)
Proteasome [BR:ssc03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    100519020 (UBQLN4)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Ubiquitin_5 YukD Rad60-SLD_2 DUF2407 CUE HOIP-UBA Arm_2
Other DBs
NCBI-GeneID: 100519020
NCBI-ProteinID: XP_003125749
Ensembl: ENSSSCG00000006500
UniProt: A0A480Y2F0 A0A4X1VYL3
Position
4
AA seq 601 aa
MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKAQDQTTATASSPSTPDPASAPSTTPASPATPAQ
PSTSGSAASDTGSGSRRSSGGGPSPGTGEGPPSATASILSGFGGILGLGSLGLGSANFME
LQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLN
NPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQ
FGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHP
TVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQ
TEAPGLVPSLGSFGMSRTPAPSAGSSAGSAPEAPTSSPAAPATSSPTGASSAQQQLMQQM
IQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQL
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcggagccgagcggggccgagacgaggcccccgattcgggtcaccgtcaagacccct
aaggacaaggaggaaattgtgatctgcgatcgagcctcggtcaaggagttcaaagaggaa
atctcccggagatttaaggctcagcaggatcagctggtcctgatcttcgcgggcaagatc
ctcaaggatggggacacattgaaccagcatgggatcaaggatgggctcactgtccatctg
gtcatcaagacccctcagaaggctcaagatcagaccactgccactgcttcttccccttcc
actccagacccagcctcagcaccctccaccacgcctgcttcacccgccacccctgcccag
ccctccacctctggcagtgccgcttcggatactggcagtggaagccgaaggagcagtgga
ggaggtccctccccagggactggggagggacctcccagtgccactgcatccatactctct
ggctttgggggcatcctgggcctgggcagcctgggcctgggctccgccaacttcatggaa
ctgcagcagcagatgcagaggcagctgatgtccaatcctgagatgctgtcgcagatcatg
gagaaccccctggtccaggacatgatgtctaaccctgacctgatgcgccacatgatcatg
gccaaccctcagatgcagcagctgatggagcgaaaccctgagatcagccacatgctcaac
aaccctgagctcatgaggcagacgatggagcttgctcggaatccagccatgatgcaggag
atgatgcggaaccaggaccgggccctgagcaacctggagagcatccccggagggtataat
gccctccgccgcatgtacacggacatccaggagcccatgtttagtgccgcccgggaacag
tttggcaacaatcccttctcttccctggccgggaactccgacagctcatcctcccagcct
ctgcggactgagaatcgagagcccctccctaacccctggagcccctcgccccccacctcc
caggcccccgggtccggtggggagggcaccggaggatcggggaccagccaggtgcacccg
acagtctcgaacccctttgggatcaatgcggctagcctggggtcagggatgttcaacagc
ccagaaatgcaggccctcctccagcagatctctgagaacccccagctgatgcagaacgtg
atatcggccccctacatgcgcagcatgatgcagacacttgcccagaaccctgactttgct
gctcagatgatggtgaacgtgccgcttttcgcggggaacccccagctgcaggagcagctc
cgcctgcagctcccggtcttcctgcagcagatgcagaacccagagtcgctctccattctc
accaatccccgcgccatgcaggcgctgctgcagatccagcagggactgcagaccttgcag
accgaggcccccgggctggtacccagccttggctcctttgggatgtcccggaccccagca
ccctcggcaggcagcagtgccgggtctgcacccgaggctcccacctcctcgccagccgcg
ccagccacatcgtctccaacaggggcctccagtgctcagcagcagcttatgcagcagatg
atccagcttttggctggaagtggaaactcacaggtgcagacgccagaagtgagatttcag
cagcagctggagcagctcaactccatgggcttcatcaatcgtgaagccaacctgcaggcc
ctgatcgccacaggaggggacatcaacgcagctatcgagagactcctgggctctcagctc
tcctaa

DBGET integrated database retrieval system