KEGG   Sus scrofa (pig): 100519233Help
Entry
100519233         CDS       T01009                                 

Gene name
VPS41
Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100519233 (VPS41)
Membrane trafficking [BR:ssc04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    100519233 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin ANAPC4_WD40 Vps39_1 Vps39_2 zf-RING_5 RIG-I_C zf-rbx1 zf-RING_2 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 100519233
NCBI-ProteinID: XP_003134954
Ensembl: ENSSSCG00000016772 ENSSSCG00000025376
UniProt: A0A4X1UMY5
Position
18
AA seq 854 aa AA seqDB search
MAEAEERETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLAL
GTHYGKVYLLDVQGNITQKFDVSCVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFH
ETFDCPIKIIAVHPHFLRSSCKQFVTGGKKLLLFERSWMSRWKSSVLHEGEGNIRSVKWR
GHLIAWANNMGVKIFDVTSKQRITNVPRDDVSLRPDMYPCSLCWKDSVTLIVGWGTSVKI
CSVKERHAGEMRDLPSRYVEIVSQFETEFYISGLAPLWDQLVVLSYVKEVSEKTESEYCA
RPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEHSEGESLFYIVSPRDVVVAKER
DQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVEKGEYDAAARKCQK
ILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMTLHEFLESDYEGFATLI
REWPGDLYNNSVIVQAVRGHLKKDSQNRTLLKTLAELYTYDKNYSSALEIYLTLRHKDAF
QLIHKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHK
LFRRDHRKGQRYHEKQISLYAEYDRPNLLPFLRDSIHCPLEKALEICQQRNFVEETVYLL
SRMGNSRSALKMITQELQDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTH
VDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQM
KGVLVDEENICESCLSPVLPSDAAKPFSVVVFHCRHMFHKECLPVPSMSSPAQFCNICSA
KHRGPGSAILEMKK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcagaggagcgggaaaccgggtctcttgaagaatctacagatgagtctgag
gaagaagaaagtgaggaggagcccaaactgaagtatgaaaggctctccaatggggtaacg
gaaatccttcagaaggatgcggccagctgcatgacagtccatgacaagttcttggccctg
ggcacgcattacggcaaagtgtatctgctggacgtgcaggggaacatcactcagaagttc
gatgtaagttgcgtgaagataaatcagataagcctggatgaaagcggagagcacatgggc
gtgtgttccgaggacggcaaggttcaggtgtttggactgtattctggagaagaatttcat
gagactttcgactgtcccattaaaatcatcgccgtgcatccacatttcctgaggtccagc
tgcaagcagttcgtgaccggcggcaagaagttgctgctgttcgaacggtcttggatgagc
aggtggaagtcgtcggttctgcatgaaggagaagggaacatcaggagcgtgaagtggagg
ggccatctgattgcctgggcgaacaacatgggtgtgaagatttttgacgtcacctcaaag
cagaggatcaccaacgtgcccagggacgatgtgagcctccgcccggacatgtacccttgc
agcctctgctggaaggacagcgtgaccctgattgttggctggggaacatctgtcaagata
tgctcggtgaaggagcggcacgccggcgagatgcgggacctaccgagtcgatacgttgaa
atagtgtctcagtttgaaactgaattctacatcagcgggctggcgcctctctgggatcag
ctggtcgtcctttcctacgtcaaggaggtttcggaaaaaacggaaagcgaatactgcgcc
aggcccagactggatatcatccagccgctctcggagacctgcgaagagatttcttctgat
gctctgactgtgaggggcttccaggaaaatgaatgcagagattatcacttagagcactcg
gaaggggagtcgctcttctacatcgtgagtccaagagatgttgtcgttgccaaggaacgt
gaccaagacgaccacatcgactggctcctcgagaagaagaaatacgaggaagctctgatg
gcagctgaaatcagccaaaagaacattaaaagacataagattctggacatcggcttggcc
tacatcaaccacctggtggagaagggggagtacgacgcagcggcacgcaaatgccagaaa
attcttgggaaaaatgcagcactctgggaatatgaagtttataaatttaaagaaattgga
cagcttaaggctattagtccttatttgccaagaggggatccagttctgaaaccactcatc
tatgaaatgaccctccatgaatttttggaaagtgattatgagggttttgccacgctgatc
cgggaatggcctggagatctgtacaacaactcggtaatcgttcaggcagttcggggtcac
ctgaagaaagacagtcagaacaggactctacttaaaaccctagcagaactgtacacctat
gacaagaactacagcagcgccttggagatatacctaaccttaagacacaaggacgccttc
cagctgatccacaagcataaccttttcagttctatcaaggataaaattgttttactaatg
gattttgattccgagaaagctgtcgacatgcttctggacaacgaagataaaatttcaatt
aaaaaggttgtggaagaattggaagacagaccggagctgcagcacgtgtatctgcacaag
cttttccggagagaccatcgtaaggggcagcgctaccacgagaagcagatcagcctctac
gccgaatacgaccgtccgaacctgctcccgtttctccgagacagcatccactgccccctg
gagaaggctcttgagatctgtcaacagaggaactttgtggaagagacagtttatcttctg
agccgcatgggcaacagccggagcgccctgaagatgatcacgcaggagctgcaggacgtc
gacaaagccatcgaattcgccaaggagcaggacgacggggagctctgggaagacctgatt
ttatattccatcgacaagccaccgtttatcaccggcttgctgaataacatcggcacccat
gttgacccaattctcctgattcaccgtattaaggaagggatggagattcctaacctgaga
gactccttggtcaaaatcctgcaagactacaatttgcagattctgcttcgtgaaggctgc
aagaagattctggtcgccgactctttgtccttactaaagaagatgcaccgaacccagatg
aaaggcgtcctggtggatgaggagaacatctgcgagtcgtgcctgtccccggtcctcccc
tcagacgcggccaagcccttcagcgtggtggtcttccactgccggcacatgttccacaag
gagtgcctgcccgtgcccagcatgagctcccctgcacagttctgcaacatctgcagcgcc
aagcaccggggcccgggaagtgccattttggagatgaaaaaatag

DBGET integrated database retrieval system