KEGG   Sus scrofa (pig): 100519258Help
Entry
100519258         CDS       T01009                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform isoform X2
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00071  Fatty acid degradation
ssc01212  Fatty acid metabolism
ssc03320  PPAR signaling pathway
ssc04152  AMPK signaling pathway
ssc04714  Thermogenesis
ssc04920  Adipocytokine signaling pathway
ssc04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100519258 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100519258 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100519258 (CPT1C)
   04920 Adipocytokine signaling pathway
    100519258 (CPT1C)
   03320 PPAR signaling pathway
    100519258 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    100519258 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssc03029]
    100519258 (CPT1C)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100519258 (CPT1C)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100519258 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 100519258
NCBI-ProteinID: XP_013854109
Ensembl: ENSSSCG00000024872
Position
6
AA seq 665 aa AA seqDB search
MGGPDLHTHVALRLLLSYHGWLLETHGVMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQ
PVPAVQDTVRKYLESVRPVLCEEDFEWISALAREFLKLQASLLQWYLQLKYWWASNYVSD
WWEEFVYLRSRNSLMVNSNYYMMDFLNVTPTPVQAARAGNAVHALLLYRHRLNRQEIFPT
LLMGMRPLCSAQYEKIFNTTRIPGVHRDHIHHLRDSRHVAVFHRGRFFRVGTHSQSGLLS
PRALEQQFQRILDDPSPACPHEEHLAALTAAPRDMWAQVRKSLKTQAEEALEAVEGAAFF
VSLDSEPAGDAAGDTPEPSGDSAASLDAYAHALLAGRGHDRWFDKSFSLIIFSNGKLGLS
VEHAWADCPISGHMWEFTLATECFQLGYSADGHCKGHPDPSLPQPQRLHWDLPDKIHLSI
SLALRGAQALAENIDCHVFPFSHFGKSFIKRCHLSSDSFIQTALQLAHFRDRGRFCLTYE
SAMTRLFLEGRTETVRSCTREACSFVRAMEHQEKTDPQCLALFRLAVDKHQALLKAAMSG
QGVDRHLFALYIVSQFLRLQSPFLDQVHSEQWQLATSQIPVQQMHLFDIHNYPDYVSSGG
GFGPADEHGYGVSYIFTGEDTITFHISSKKSSTRTDSHRLGQHIRDALLDVAALFQEGQH
LKRRA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggggggccctgatcttcacactcacgtggccctgaggctccttctgtcctaccacggc
tggctccttgaaacccatggggtcatgtcctcacccaccaagacctggctggctctggtt
cgcatcttctccggccgccacccaatgctcttcagttaccagcgctccctgcctcgccag
cctgtgcccgctgtgcaggacaccgtgcgcaagtatctggagtctgtccgacctgtgctc
tgtgaagaggacttcgagtggatctcggccctagcacgggaattcctgaagctgcaggca
tcgctgctgcagtggtacctgcagctcaaatattggtgggcgtccaattatgtcagtgac
tggtgggaagagtttgtgtacctgcgctcccggaactcactgatggtgaatagcaactac
tacatgatggacttcctgaacgttaccccaactcccgtccaggctgctcgtgcagggaac
gcggtccacgccctcctcctgtaccgccaccgcctgaaccgccaggagatctttccgacg
ttgctgatgggaatgcggcccttatgctctgcccagtatgagaagatattcaacacgacg
cgaattcctggggtccacagagaccacatccaccacctccgtgacagccgacacgtggcc
gtcttccaccggggccgattcttccgcgtggggacgcactcccaaagcggcctgctttcc
ccaagggccctggagcagcagttccagcgaatcctggatgacccctctcccgcctgcccc
cacgaggagcatctggcggctctgaccgcggctccgagggacatgtgggctcaggtgagg
aagtccctaaagacccaggcagaggaggccctggaggctgtggaaggggctgctttcttt
gtatcactggactctgagcccgcgggggacgctgcaggggacactcctgagccctcgggg
gactccgcagcttccctagatgcctatgcccatgccctgctggccggcaggggccatgac
cgctggtttgacaaatccttctccctaatcatcttctccaacgggaagctgggcctcagc
gtggaacacgcgtgggcggactgccccatctcaggacacatgtgggagttcactctggcc
acagaatgctttcagctgggctactcggcagatggtcactgcaagggccatcctgaccca
tcgctgccccagccccagcggctgcactgggaccttccagacaagatccatctatccatc
tctctagccctgaggggagcccaggccttggctgaaaacatcgactgccacgtcttcccc
ttctcccactttggcaagagcttcatcaaacgctgccacctgtcttcagacagcttcatc
cagacggccttgcagctggcccacttccgggacaggggtcgattctgcctgacctatgag
tcagccatgactcgcctgttcctggaaggccggacagagacggtgcgttcttgcacgagg
gaggcctgcagctttgtgagagccatggaacaccaagagaagacagacccacagtgcctc
gccctgttccgcctggcggtggacaagcaccaggctctgctgaaggcagcgatgagcggc
cagggggtcgaccgccacctctttgctctctacatcgtgtcgcaattcctccgcctacag
tcgcccttcctggaccaggttcactcggagcagtggcagctggccaccagccagattcct
gttcagcaaatgcacctgtttgacatccacaactatccggactacgtttcctctggtggt
ggatttgggcctgccgatgagcatggctatggtgtttcttacatcttcactggggaggac
acgattaccttccacatctctagcaaaaaatcaagcacaagaacggactcccaccggctg
ggccagcacatcagggatgcattgctggacgtggcagccctattccaggaggggcagcat
cttaagcgccgggcctga

DBGET integrated database retrieval system