KEGG   Sus scrofa (pig): 100519451Help
Entry
100519451         CDS       T01009                                 

Gene name
ZCCHC3
Definition
(RefSeq) zinc finger CCHC domain-containing protein 3
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC zf-CCHC_2
Motif
Other DBs
NCBI-GeneID: 100519451
NCBI-ProteinID: XP_003134416
Ensembl: ENSSSCG00000007211
UniProt: F1S7I8
Position
17
AA seq 402 aa AA seqDB search
MATGGGAEEERKRGRPQLLPPGRPAPRAEEAEGGREKMGWAQVVKNLAEKKGEFRESRPP
RREEEGGAGGGLCAPAGLAAPGLGDFPPAGRGDPKGRRRDPAGEAADARKKKGAAEAGRR
KKAEVAAMAGPSRPGAAEDAAERPPQDETAAATGPGAGPGKGRFLVRICFQGDEGACPTR
DFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKREQEDCWEN
FVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEI
ELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGH
LSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggcggcggcgcggaggaggagaggaagagggggcggccgcagctcctgccc
cccgggcgcccggcgcccagggctgaggaagctgagggcggccgcgagaagatgggctgg
gcccaggtcgtgaagaacctggccgaaaagaagggcgaattccgcgagtcgcggccgccg
cggcgggaggaagaaggcggcgcaggaggcgggctttgcgcccccgcgggcctggcagcg
ccgggcctcggcgacttccccccggccggccgcggggacccgaagggtcgccgaagggac
ccggccggcgaggcggcggacgcccgcaagaagaagggcgcagccgaggcaggcaggagg
aagaaggccgaggtggcggccatggcgggcccgagcaggcccggcgcggccgaggacgcg
gccgagcggcctccccaggacgagacggcggcggcgacgggccccggggcgggcccgggc
aagggccgctttctcgtgcgcatctgtttccagggagacgaaggcgcttgcccgacccgg
gacttcgtagtgggcgcgctcatcctgcgctccatcggcatggacccgagcgacatctac
gcggttatccagattcccggcagccgcgagttcgacgtgagcttccgctccgcggagaaa
ctggccctgttcctacgcgtctacgaggagaagcgcgagcaggaggactgctgggagaac
tttgtggtgctggggcggagcaagtccagcttgaagacgctcttcatcctcttccggaac
gagacggtggacgtggaggacatcgtgacctggctcaagcgccactgcgatgtgctggcc
gtgccagtgaaagtgaccgacaggtttgggatctggaccggggagtacaagtgcgagatc
gagctgcgccagggggagggcggggtcaggcacctgccgggagccttcttcctgggggcc
gagaggggctacagttggtacaaagggcagcccaagacgtgctttaaatgtggttcccgg
acccacatgagcggcagctgcacacaggacaggtgcttcaggtgcggggaggaagggcac
ctgagcccttactgccggaagggcatcgtctgcaacctctgtggcaagcgaggacacgcc
tttgcccagtgtcccaaagccgttcacaattccgtggcagctcagctaaccggcgtggcc
gggcactga

DBGET integrated database retrieval system