KEGG   Sus scrofa (pig): 100519546
Entry
100519546         CDS       T01009                                 

Gene name
KPTN
Definition
(RefSeq) kaptin isoform X1
  KO
K23295  KICSTOR complex protein kaptin
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100519546 (KPTN)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Other autophagy associated proteins
   KICSTOR complex
    100519546 (KPTN)
SSDB
Motif
Pfam: VCBS
Other DBs
NCBI-GeneID: 100519546
NCBI-ProteinID: XP_003127312
Ensembl: ENSSSCG00000003121
UniProt: A0A481D0U4
Position
6
AA seq 435 aa
MGEVAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQK
IRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEP
GSEYNLDSIAQSCLNLELQFTPFQLCHAEVQIGGQLETVFLLSGNDLAIHLYKENEGLHQ
FEEQPVENLFPELTNLTSSVLWLDVHNLPGTSRRLSALGCQSGYVRVAHVDRQSRVVLQT
WTILQDGPISRVTVFSLSAPAGAEDRPEREEYSVLVASMLEPAVVYRDLLSRGLEDQLLL
PGSDQFDSVLCGLVTDIDLDGRPEVLVATYGQELLCYKYCGPERGLPGARGGFRLLWQRS
FSSPLLAMAHVDLTGDGLRELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRQPPR
PGDRVGARPAETPAS
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgggggaggtggctgtggccgcggggccttgtccgctgcgcgaggacagcttcacgcgc
ttctcgtcgcagagcaatgtatacgggctggcgggcggcgcgggcgggcgcggggagctg
ctggccgccacccttaaaggcaaggtgctgggcttccgctaccaagacctccgacagaaa
atccggcccgtggccaaggagctgcagttcaattacattcccgtggatgcagagattgtc
tccatcgacaccttcaacaaatcgcccccaaagcgaggcctggttgtggggatcacgttc
atcaaggattccggggacaagggcagcccttttctgaacatttactgtgactatgagcct
ggctctgagtacaaccttgactccattgcccagagctgcctgaacctggagctccagttc
actcctttccagctgtgccatgcagaggtccagattgggggtcagctggagaccgtgttt
ctcctgagtgggaatgacctggccattcatctctacaaagagaacgaggggctgcaccag
tttgaagaacagcctgtggaaaacctcttcccagagctcacgaacctgaccagtagcgtc
ctctggcttgacgtgcacaacctgcccggcacgtcccggcgactctcagcactcggctgt
cagagcggctacgtccgtgtcgcccacgtggaccggcagagtcgagtggtgctgcagacg
tggaccatcctacaggacggccccatctcccgcgtgaccgtgttcagcctctcagcgccc
gcaggggccgaggacagacccgagcgggaggagtacagcgtgctggtggccagcatgctg
gagccagcggtggtgtaccgggacctgctgagccggggcctcgaggaccagctcctcctt
cctggcagcgaccagtttgacagcgtcctctgcggcctggtcaccgacatcgatttggac
gggcggccggaagtcctggtggccacctacggacaggagctgctgtgttacaagtactgc
ggcccggagcgcgggctccccggggccaggggcggcttccgcctgctctggcagcggagc
ttctccagccccctactggccatggcgcatgtggacctgactggggacggactgcgcgag
ctggccgtggtctccctgaagggcgtgcacatcctgcagcacagcctgatccaggcctca
gaactggtcctgacccggcttcggcatcaggtggagcagaggcgacgtcagccaccgagg
ccgggggacagggtgggtgccaggcctgccgagacccctgcctcctga

DBGET integrated database retrieval system