KEGG   Sus scrofa (pig): 100519548Help
Entry
100519548         CDS       T01009                                 

Gene name
AGMAT
Definition
(RefSeq) agmatinase, mitochondrial isoform X2
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00330  Arginine and proline metabolism
ssc01100  Metabolic pathways
Module
ssc_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100519548 (AGMAT)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100519548 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 100519548
NCBI-ProteinID: XP_003127670
Ensembl: ENSSSCG00000003463
UniProt: F1SUU6
Position
6
AA seq 361 aa AA seqDB search
MLQLLVSGCARGLRAGVGVRGLLPLHPASPATGLGNPGLSPSRQASNTPRNQPPKADFVA
RSVGICSMMRLPVQASPEGLDAAFIGVPLDIGTSNRPGARYGPRRIREESVLLRPANPST
GALPFQSLMVADLGDVNVNLYNLQDSCRLIREAYQKIVAAGCIPLTLGGDHTITYPILQA
MSEKHGPVGLVHVDAHMDTADKALGEKLYHGSPFRRCVEEGLLDCKRVVQIGIRGSSLTL
DTYSYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGKPIYISFDIDSLDPAYAPGTGTP
EIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPFGNTALLAANLLFEMLCVLPKVTV
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagctgctggtttctggctgtgcccgaggcctaagggccggcgtgggcgtgcgg
gggctgcttcccctgcacccagcgagtcctgctacagggcttggcaacccaggcctcagc
ccgagccgccaagcctccaacactccccggaaccagcctcccaaagctgatttcgtggcc
cggtcagtgggcatctgttccatgatgcggctgcccgtgcaggcctcccccgagggactg
gacgctgccttcatcggggtgcccctggacattgggacctccaaccggcccggggcaaga
tatggaccccgacggatccgggaggaatcagtgctgcttcgcccggccaaccccagcacg
ggagccctccccttccagtccctcatggtcgcagacctaggagatgtgaatgtcaacctt
tacaaccttcaggacagctgccgcctcattcgagaggcctatcagaaaatcgtggcagct
ggctgtatccctctgaccttgggtggagatcacaccatcacatatcccatattgcaggcg
atgtcagaaaagcacggccccgtggggctggtgcatgtggacgcgcacatggacacggcg
gacaaggccctgggggagaagctctaccacgggtcgccctttcgccgatgcgtggaggag
ggactcttggactgtaagcgcgtggtgcagattggcatccggggctcttccctgaccttg
gacacctacagctatagccggagccagggctttcgggtggtcctggctgaagactgctgg
ctgaagtcactggttcctctgatgggggaagtgaggcagcagatgggaggcaaacccatt
tatatcagctttgatattgacagcttggatcccgcctatgccccagggacggggacacct
gaaattgctggcctgaccccgagtcaggctctggagatcatccgaggttgtcaaggcctg
aacgtggtgggttgtgatcttgtggaagtttcgccgccatacgatccttttggaaacacg
gccctcctggcggctaacttgctgtttgagatgctgtgtgttctccccaaagtgacagtc
gtctga

DBGET integrated database retrieval system