KEGG   Sus scrofa (pig): 100519805Help
Entry
100519805         CDS       T01009                                 

Gene name
TBC1D20
Definition
(RefSeq) TBC1 domain family member 20
  KO
K20372  TBC1 domain family member 20
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100519805 (TBC1D20)
Membrane trafficking [BR:ssc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100519805 (TBC1D20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 100519805
NCBI-ProteinID: NP_001231549
UniProt: A0A287A634 A0A4X1SPY5
Position
17
AA seq 403 aa AA seqDB search
MALRSAQGDGPTSPRWDGGAEKADFNAKKKKKVAEIYQALNSDPTDVAALRRMAISEGGL
LTDEIRRKVWPKLLNVNTSDPPPTSGKNLRQLSKDYQQVLLDVRRSLRRFPPGMPEEQRE
GLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDP
TMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYD
FFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV
QFPPSELAREAAAQQQAERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLT
KPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggccctccggagtgcgcagggtgacggccccacgtctcctcgctgggacggcggcgcg
gagaaggcagactttaatgccaaaaagaaaaagaaagtggcagagatctaccaggctctg
aacagtgaccccaccgatgtggctgcccttagacgcatggctatcagtgaaggagggctg
ctgactgatgagatcagacggaaagtgtggcccaagctcctcaatgtcaacaccagtgat
ccacctcctacatcagggaagaacctcagacagctgagcaaggactaccagcaagtgctg
ctggacgtccggcggtctctacggcggttccctcctggcatgccagaagagcagagggaa
gggctgcaggaagagctgatcgacatcatcctcctcatcctggagcgcaaccctcagctg
cactactaccagggctaccacgacatcgtggtcacgtttctgctggtggtaggcgagagg
ctggccacatccctggtggaaaaattgtctacccaccacctcagggatttcatggaccca
acaatggacaacaccaagcatatattaaactatctgatgcccatcattgaccaggtgaat
ccagaactccatgacttcatgcagagtgctgaggtggggaccatctttgcgctcagctgg
ctcatcacctggtttgggcacgtcctgtcagacttcaggcacgtcgtgcggttatacgac
ttcttcctggcctgccacccgctgatgcccatttactttgcagctgtgatcgtgttgtat
cgagagcaggaagtcctggactgtgactgtgacatggcctcggtccaccacctgttgtcc
cagatccctcaggacctgccctatgagacgctgatcagtagagcaggagacctctttgtg
cagtttcccccgtccgaacttgctcgggaggccgctgcccagcagcaggccgagagaacg
gcagcctctaccttcaaagactttgagctggcatcagcccagcagaggcctgacatggtg
ctgaggcagcggtttcggggacttctgcggcctgaggatcgaacaaaagatgtcctgacc
aaaccaaggaccaaccgctttgtgaagctggcggtgatggggctgacggtggcacttgga
gcggctgctctggctgtggtgaagagtgccctggagtgggccccgaagtttcaactgcag
ctgtttccctaa

DBGET integrated database retrieval system