KEGG   Sus scrofa (pig): 100519988Help
Entry
100519988         CDS       T01009                                 

Gene name
FBXO30
Definition
(RefSeq) F-box only protein 30
  KO
K10307  F-box protein 30
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100519988 (FBXO30)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100519988 (FBXO30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box_4 zf-TRAF_2 F-box F-box-like zf-TRAF
Motif
Other DBs
NCBI-GeneID: 100519988
NCBI-ProteinID: XP_003121199
Ensembl: ENSSSCG00000004121
UniProt: A0A4X1VRA2 A0A287ASK2
Position
1
AA seq 741 aa AA seqDB search
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPC
LNSDFGCPFTMARNKVAEHLEACPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
DMALALQDQRMLLESLKVATMMSKATDKVSEPREQISVKSSVSEIPHTNGLVSVDEESYG
ALYQATVETTRSLAAALDILNTATRDIGMLSSSLCTSPNEINEEQNSRESLKDQDHLYAD
EIGAVGGIDHNDTSQNAQSEQNGSSDLLCDLDASSYGSSALCNGFPLEDICTQVIEQNQN
LHGDSKQNNLTNGECVASDGISEPSSSLSVAAQLREVIPANALPNGTVQHILMPDDDEGD
LCWRKVDLGDLRNMDVLSFNHPPSFKFLSNSCWSKPKEDKAVDTSDLEVAEDPMGLQGID
LITAALLFCLGDSPGGRGISDSRMVDVYHIDFGTQTFSLPSAILATNTMVGEIASASACD
HANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFKNVHGDIH
AGLNGWMEQRCPLAYYGCTYSQRRFCPSTQGAKIIHDRHLRSFGVQPSVSTVLVEPARNC
VLGLHNDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSKLMRDVCGSLLQSRGMVILQWGKR
KYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNIVEKREEAVPLPCM
CVTRELTKEGRSLRSVLKPVL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagctgcagcattcgcactgcgtgaattgtgtcagtagacggtgtatgacc
agaccagagcctgggatttcctgtgacttgattggttgtccattggtttgtggagcagtt
ttccattcttgtaaagctgatgagcatcgacttttatgtccatttgaacgagtgccttgt
ttaaatagtgactttggatgtccatttacaatggctcgaaataaagttgccgaacatcta
gaagcatgtcctgcaagtgtggtgtgctgtactatggagtggaaccgatggccagttagt
tatgcagacagaaaatcttacgaaaatctaagcagagatgttgatgaagtggcacaatta
gatatggccttggcccttcaagaccaaaggatgctcttagaatctctcaaagtagccacc
atgatgtcaaaagcaactgataaggtatcagaacctagagaacagatctcagttaaatca
agtgtctcagaaataccacatactaatggtttggtatctgttgatgaagaatcttatggt
gcactttatcaagctactgttgaaacaactagaagtttggctgccgctttagacatcctg
aataccgccacaagagacattggcatgttaagttcgagtctttgtacttccccaaatgaa
ataaatgaagagcagaattccagagaaagcttgaaagaccaagatcatctttatgctgat
gagataggagcagtaggtgggattgaccataatgacacaagtcagaatgcccaatctgaa
caaaatggttcaagtgatttattatgtgacttggatgccagttcttatggcagttctgct
ctttgtaatggcttccctttggaagatatatgcacacaggtcatagagcagaatcagaat
ttacatggtgactcaaaacaaaataacttaacaaatggagaatgtgtagcatcagatggc
atttcagaaccttctagttcactttcagtagcagcacaacttagggaagtaataccagct
aatgctttgcctaatggcactgttcagcatatcctcatgccagatgatgatgaaggagac
ttgtgttggagaaaagtagacttgggggacctgaggaatatggatgttttatctttcaat
catcctccttcattcaaatttctttctaactcatgttggtctaaaccaaaggaagataaa
gcagtagatacatcagatttggaagttgcagaagatccaatgggcctccaaggaatagat
ctaatcacagcagcactactgttttgtctaggagattctccaggtgggaggggtatatct
gatagtcgcatggttgatgtttatcacattgactttgggactcagactttttcacttcca
tctgcaatattagctacaaatacaatggttggggaaatagcttcagcttcagcttgtgat
catgccaacccacagctttcaaatccaagtccttttcagacacttgggctggatttagta
ttggaatgtgtcgctaggtaccaacccaaacagcgttcaatgtttacatttgtttgtgga
cagttatttagaagaaaagaattttcatcgcattttaagaatgtgcatggtgacattcat
gctggactcaatggctggatggaacagaggtgtcctttagcatattatggttgtacctat
tctcagcgtagattctgtccatcaacacaaggagcaaagattatacatgaccgccatttg
aggtcatttggagttcagccatctgtatctacagtattagtagagcctgctagaaactgt
gtgttgggattacataatgaccatctaagtagccttccttttgaggtcctacagcatatt
gcaggctttcttgatggcttcagtttatgccagctctcctgtgtatccaagttaatgagg
gatgtgtgtggcagtcttcttcagtctcgcggaatggtcatactgcagtgggggaaaagg
aagtatccagaaggaaattcttcatggcagataaaagaaaaggtatggcgattcagtaca
gctttctgttctgtcaatgaatggaaatttgctgacatcctaagtatggctgaccacttg
aagaaatgcagttacaatattgtagagaaacgggaggaagcagtcccattgccatgtatg
tgtgtgacacgagaactcactaaagaaggacgttcacttcgctcagttttaaaacctgta
ctttaa

DBGET integrated database retrieval system