KEGG   Sus scrofa (pig): 100520320Help
Entry
100520320         CDS       T01009                                 

Gene name
DIXDC1
Definition
(RefSeq) LOW QUALITY PROTEIN: dixin
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: DIX CH CAMSAP_CH Thiamine_BP CH_2
Motif
Other DBs
NCBI-GeneID: 100520320
NCBI-ProteinID: XP_003129917
Ensembl: ENSSSCG00000015036
UniProt: A0A481CBU2
Position
9
AA seq 685 aa AA seqDB search
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLSGVQTSPSNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVEGNLKSIMRLVL
ALAAHFKPGSSRTVSQGRDAGAPLQSHQPHCATAVAQGAAAALADVCHDMSRSGRDVFRY
RQRNSSVDEEIENPCWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE
KADFVIIPSEGIENRTEEIDSPLSRDWRPGSPGTYLETSWEEQLLEQQEHLEKEMEEAKK
MISGLQALLLNGXLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKY
KQEARNLQGIKDALQQRLTXQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
GEYKKELGQKDRLLQQHQAKLEEALRKLSEASYQQVDLERELEHKDVLLAHCMKREAEEV
TNCNSHNSQSNGFXLPVTGKGAASVTHRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSL
EQGISSLMERLHALETQRKQERKVRGKSPRTQACSEYRESWPPNSRLPHSQSSPAVSSAC
TKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEVFH
DDDAIPGWEGKIVAWVEEDHGENEC
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgctagcctgtttgacccgggggaacttactggacgttctgcaggagggcttcaatgag
caacagctgcaggcgtatgtggcctgggtgaacgcacagctgaagaagaggccggcggtg
aagcctgtgcaggacctgcggcaggacctccgcgatggggtgatcctggcatatctcatc
gagattgttgcaggagaaaagctgagtggggtacagacaagtcccagtaaccaacaggag
atgaagaataacgtggagaaagtgttacagtttgtagcctccaaaaagattcgtatgcac
cagacttcagctaaagatattgtggaaggcaacctgaagtctatcatgaggctggtcctg
gccctggcagctcatttcaaacctggctccagcaggacagtgagccaaggacgggatgcc
ggagcccctctgcagagtcaccagccacattgtgccactgctgtggcccagggagcagct
gccgctctggctgatgtgtgtcatgacatgtcacggtcaggacgggatgtctttcgatat
agacagaggaacagcagcgtggatgaggagatcgagaatccgtgctggagcgtgcgagcc
ctggtgcagcagtatgaggggcagcaaagatccccgtccgagtccagctgctccagcctg
acttcccccagtcctatccacagtgcgaagagtgaatccattataacccagtcggaggag
aaggcagatttcgtgatcattccctctgaaggaatagagaacagaacagaagagatagat
tcaccgttatcccgggactggcgaccaggcagccccgggacctatctggagacttcatgg
gaggaacagctattggaacaacaagaacatttggaaaaagaaatggaggaagccaagaaa
atgatatcgggattacaggccttactgctcaatggantcttacccgaagatgaacaggag
agacccttggccctctgtgaaccaggagtcaatcccgaggaacagctgattataatccag
agtcgtctagatcagagtatggaggagaatcaggacctaaagaaggagctgctgaaatat
aaacaagaagccagaaacttacaggggataaaggatgccttgcagcagaggctgactnca
caggacacatctgtccttcagctcaaacaggaactactgagggcaaatatggacaaagat
gagctgcacaaccagaacgtggatctgcagaggaagctggatgagaggaaccggctcttg
ggagaatataaaaaagagctggggcagaaggaccgcctcctgcagcagcaccaggccaag
ttggaagaagcacttcggaaactctctgaggccagttaccagcaggtggatctggagcgg
gagctggaacacaaagacgtccttttggctcactgcatgaaaagagaggcagaggaggtg
accaactgcaatagtcacaactctcagagcaatggttttnctcttccagtgacaggaaaa
ggagctgcttcagtcactcacagagggacaagcgacctgcagctggttcgagatgccctc
cgaagcctgcgcaacagcttcagcggccacgatcctcagcaccacaccatcgacagcttg
gagcagggcatctccagcctcatggagcgcctgcatgccctggagacccagaggaagcaa
gagagaaaggttcggggcaagtcacccagaactcaagcttgtagtgaataccgggaatcc
tggccccctaattcaaggttgcctcactcacagagctctccagctgtcagcagcgcctgc
acgaaagtgctctatttcactgaccggtcacttacgcccttcatggtcaacataccaaag
aggttgggggaggtgacactgaaggattttaaagcagctattgatcgagaaggaaatcac
cgttatcacttcaaagccctggatcctgagtttggcaccgtcaaagaggaggttttccac
gatgatgatgccatccctggatgggaagggaaaattgtagcctgggtggaagaagaccac
ggagagaatgaatgctga

DBGET integrated database retrieval system