KEGG   Sus scrofa (pig): 100520472
Entry
100520472         CDS       T01009                                 

Gene name
GABRA5
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-5 isoform X1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04723  Retrograde endocannabinoid signaling
ssc04727  GABAergic synapse
ssc04742  Taste transduction
ssc05032  Morphine addiction
ssc05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100520472 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100520472 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    100520472 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    100520472 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100520472 (GABRA5)
   05033 Nicotine addiction
    100520472 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100520472 (GABRA5)
Ion channels [BR:ssc04040]
 Ligand-gated channels
  GABA-A
   100520472 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Other DBs
NCBI-GeneID: 100520472
NCBI-ProteinID: XP_003121696
Ensembl: ENSSSCG00000004827
UniProt: F1SR89 A0A4X1UE43
Position
1
AA seq 463 aa
MDNGMFSSFIMIKNLLLFCISMNLASHFGFSQMPTSSVKEETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNGTTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKERELTLNKSTNAYTTGKMTHPPNIPKEQTSAGTSNASSVSVKPSEDKTSENKKTY
NSISKIDKMSRIIFPVLFGTFNLVYWATYLNREPVIKGATSPK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggacaatggaatgttctctagctttatcatgatcaaaaatctccttctcttttgtatt
tccatgaacttagccagtcactttggcttttcacaaatgccaaccagttccgtaaaagag
gagaccaatgacaacatcacaatattcaccaggatcttggacgggctcctggatggctat
gacaacaggctgaggccgggactcggagagcgaatcactcaggtgagaacggacatctac
gtcaccagcttcggcccagtgtccgacacggaaatggaatacaccattgatgtgtttttc
cgacaaagctggaaagatgaaaggcttcggtttaaagggcccatgcagcgcctccctctc
aataaccttctcgccagcaaaatctggaccccagacacgttcttccacaatgggaagaag
tccattgcccacaacatgacaacaccaaacaagctgctgcggctggaggacgacggcacg
ctgctctacaccatgcgcttgaccatctctgcagaatgcccaatgcaactggaagacttc
ccaatggatgcccacgcctgccctctgaaatttggcagctacgcataccctaattcagaa
gttgtctacgtctggaccaacggcaccaccaagtcggtggtggtggcagaagacggctcc
aggctaaaccagtaccacctgatggggcagacggtgggcacagagaacatcagcaccagc
acaggtgaatacacgatcatgacggctcatttccatctgaagaggaagatcgggtacttc
gtcatccagacctacctcccctgcataatgaccgtgatcttgtcgcaagtgtccttttgg
ctaaaccgagaatcagtcccagccaggacagtgttcggggtgaccacggtgctgaccatg
acgaccctcagtatcagtgcccggaactctctgcccaaagtggcttatgcgacggccatg
gactggttcatagccgtgtgctatgcttttgtgttctctgcgctgatcgagtttgccaca
gtcaactatttcaccaagagaggctgggcctgggatggaaaaaaagccttggaagcagcc
aagatcaagaaaaaggagcgtgaacttacactaaataagtcaacaaatgcttatactact
gggaagatgacccaccccccaaacatcccaaaggagcagacctccgcaggaacctcaaat
gcatcttcagtctcagtcaaaccttctgaagacaagacttctgaaaataaaaagacttac
aacagcatcagcaagattgacaaaatgtcccgaattatattcccagtcctctttggcact
ttcaaccttgtttactgggcaacatatttgaatagggagccagtgattaaaggggctacc
tctccaaaatga

DBGET integrated database retrieval system