KEGG   Sus scrofa (pig): 100520915Help
Entry
100520915         CDS       T01009                                 

Gene name
COL11A2
Definition
(RefSeq) collagen alpha-2(XI) chain isoform X2
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100520915 (COL11A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100520915 (COL11A2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   100520915 (COL11A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 100520915
NCBI-ProteinID: XP_003128379
Ensembl: ENSSSCG00000001473
Vega: OTTSUSG00000001391
UniProt: K7GME7
Position
7
AA seq 1737 aa AA seqDB search
MERCSRCHRLLLLVPLVLGLSAAPAWAGASPVDVLRALRFPSLPDGVRRTRGICPADVAY
RVSRPAQLSAPTRQLFPGGFPKDFSLLTAVRTRPGLQAPLLTLYSAQGVRQLGLELGRPI
RFLYEDQTGRPQPPAQPVFRGLSLADGKWHRVAVAVKGQSVTLILDCKKRVTRPLPRSAH
PVLDTHGVIIFGARILDEEVFEGDVQELVIIPGVQAAYESCEQKELDCEGGWRETPLKQQ
SHRTQRSPKQQPPRLHRPQNQEPQRQSTESLYYDYEPPYYDVMTTGTTPDYQDPTPGGEE
GILESSPLPPPEEEQTDLQVPSTADRFLTEEYGEGGTEPPTGPYDYTYGYGDDYREETEL
GPALSAETAHSGAAARGPRGLKGEKGEPAVLEPGMLVEGPPGPEGPAGLTGPRGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSGAGDKGPVVAAQEAQAQAILQQ
ARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRA
GADGARGMPGEPGVKGDRGFDGLPGLPGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPR
GLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGTQGLP
GPQGAVGPHGEKGPQGKPGLPGMPGSDGPPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPR
GVKGVDGIRGLKGHKGEKGEDGFPGFKGDMGVKGDRGEVGVPGSRGEDGPEGPKGRTGPT
GDPGPPGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKPGPRGER
GPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPPGKD
GLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGAAGETGPMGERGHPGPPGPPGEQGLTGTA
GKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGLKGNEGPAGPPGPAGSPGER
GAAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVA
GEDGDKGEVGDPGQKGAKGNKGEHGPPGPPGPLGPVGQPGAAGADGEPGARGPQGHFGAK
GDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPS
GGVGNLGPPGEKGEPGESGSPGVQGEPGVKGPRGERGEKGESGQPGEVGPPGPKGPTGDD
GPKGNPGPVGFPGDPGPPGEAGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKR
GPAGTPGPEGRQGEKGAKGDPGAVGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGRP
GATGQAGPPGPVGPPGLPGLRGDTGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGST
GQKGETGIPGASGPIGPGGPPGLPGPAGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGEV
IQPLPIQMPKKTRRSVDGSRLMQEDEAMPTGGAPGSPGGLEEIFGSLDSLREEIEQMRRP
TGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVT
QFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSSGEDQDGPLKLRGANEDELSPETS
PYVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSDLGAPPRRGGVLLGPVCFMG
NT seq 5214 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtgcagccgctgccatcgcctcctcctgcttgtaccgctggtgcttgggctg
agcgcggccccggcctgggcaggtgcatcgcccgtggatgtgcttcgggccctgaggttc
ccctccctccctgatggcgtccggaggacgaggggcatctgtcctgctgatgtggcctac
cgagtgtctcgccctgcccagctcagtgcacccacccgccagctcttcccaggaggcttt
cccaaagatttctctctattgactgctgtccggacccgccctggcctccaggctccgctc
ctgactctctatagtgcccagggtgtccgacagctgggcctggagctcggccgacccatc
cgtttcctgtatgaggaccagacaggacggcctcagcccccagctcagcccgtcttccga
ggcctcagcctagcagatggcaagtggcaccgtgtagctgtggctgtgaagggccagtct
gtcactctcatccttgactgcaagaagcgtgtcacccggcccctcccccgaagtgctcat
ccagtgttggacacccatggagtgatcatctttggtgctcgtatcctggatgaagaagtc
tttgagggtgatgtccaggagcttgtcatcattccgggggtgcaagctgcctacgaatcc
tgtgaacagaaggagctggattgtgaggggggttggagggagacacctctgaaacaacag
tctcacagaacccagagatctccgaagcagcaaccaccgagactacacaggccgcaaaac
caggagccccagcgacagtccactgagtctctctactatgactacgagcccccctattac
gatgtgatgactacggggacgacccctgattatcaggaccccaccccaggtggagaggaa
ggaattctggagtcaagccccttgccaccccctgaggaggagcagacagatctccaggtc
ccctccacagccgacaggttcctgacagaggaatatggggagggtggcacagagccccca
acagggccctacgattacacctatggctatggggacgattatcgtgaggagacggaactt
ggccctgccctctctgcggagacagcccactcaggagccgctgcccgtggaccccggggg
ctgaagggagagaagggggagcctgcggtgctggaacctggcatgctggtggagggaccc
cctggtccagaaggccccgcgggattgactggtccccgtggtatccaaggcaaccccggc
cccgttggagacccgggcgagaggggcccccctggccgagcagggctccccggatcagat
ggggcccctggcccccctggcacatctctcatgctcccattccggtttggcagtggagcg
ggtgacaagggcccggtggtggcggcccaggaggctcaggcccaggcaattctgcagcag
gcacggctggcgctccgcggaccccctggccccatgggatacacgggccgccccggaccc
ttgggtcagcctgggagccctggcctgaaaggagaatctggagacctaggacctcagggc
cccagaggacctcagggcctgacgggccctccgggcaaggctgggcgaaggggccgggcg
ggtgctgatggagcccgagggatgcccggggaacctggagtgaagggtgaccgtggtttt
gatggactcccagggctacctggggagaagggacacaggggtgataccggtgcccagggc
cttcctgggccccctggtgaggatggagagaggggagatgatggcgagattgggcctcgg
gggctgcctggagagtccggacctcgaggtctccttggccccaaaggcccacctgggatt
cctggacccccaggagtccgaggcatggatggtccccacggccccaaaggaagcttgggc
ccccagggagagccaggacctcctggacaacagggcactcctgggacccagggtctccct
gggccccaaggtgccgttggccctcatggagagaagggccctcaagggaaaccaggcctc
cccggcatgcccggctcagacggacctccgggtcaccctggcaaagaaggtccccctgga
accaaaggaaaccagggtccatctggtcctcagggtcctctgggatacccaggacctcga
ggtgtcaagggtgtggacgggattcgaggtctgaaaggtcacaagggtgaaaagggcgag
gatggctttcctgggttcaaaggtgacatgggtgtgaaaggtgacaggggcgaggttgga
gtcccaggttccaggggagaggatggtcctgaggggccaaagggacgcactggacccacc
ggagaccctgggccccccgggctcatgggcgagaagggcaagctgggtgttcccggtctg
cctggctaccccggacgccagggtcccaaggggtctctgggatttcctggtttccctgga
gccagtggtgagaagggagcccggggcctctcggggaaacccgggcctcggggagaacgt
ggccccacgggtccacggggtcagcggggaccccgaggcgccactgggaagtctggagcc
aagggaacatctggtggtgatggtccccacgggccccccggagagaggggtctccctgga
cctcagggccccaacggatttcctggccccaaaggacctccgggcccccctgggaaggac
gggctgccgggacacccgggccagagaggagaagtgggtttccaaggaaagactggcccc
ccgggccccccgggagtggtgggaccccagggagccgcaggagaaaccgggcccatgggt
gagcgaggtcacccaggccccccgggccctcctggagagcaaggactgactggaacagct
ggaaaagaaggaacgaagggggaccccggtccccctggagccccaggaaaggatggtcct
gctggtctgaggggcttcccaggagagaggggccttcctggcactgcgggtggacctggt
ttgaagggaaatgaaggtccagctggtccccccggccctgcgggctctcctggggagcga
ggtgcagcaggatctgggggacccattggccccccagggcgcccgggaccacagggccct
cctggagcagcaggagagaaaggcgtcccgggggagaaaggccccatcggtcctactggc
cgcgatggggtgcagggtccagtggggcttcctggtcctgctggacccccaggcgtggca
ggagaggatggagacaagggtgaggtgggcgaccctggacagaagggcgctaaagggaac
aagggcgagcatggccctcctggaccccctggaccccttggtcctgtggggcagcctgga
gcagcgggggcagatggggagcccggtgctcggggtccccaggggcactttggtgccaaa
ggtgacgaaggaacaagaggattcaatgggcctccaggacccattggtctgcagggtttg
ccaggcccctcaggggagaagggagagacaggagacgtgggccctatgggaccaccgggc
cccccaggacctcgaggcccagctggacccaacggagctgatggtcctcaaggcccctca
ggaggtgttgggaacctgggtccccctggagagaagggggagccaggagagtcgggatct
ccgggagtccagggcgagcccggtgtcaagggtccccgcggcgagcgtggggagaaagga
gagtcggggcagcctggagaggtgggaccaccagggcctaaaggccccacgggagacgat
ggtcccaaaggaaaccccggtcctgttggttttcctggtgaccctgggcctcctggagaa
gctggcccccggggccaggatggcgctaagggggaccgtggagaggacggagagccagga
cagcctggatcccctggtcccactggggagaacggacctcctggaccacttggaaagcgg
ggtcctgccggtacccctggccctgaggggcgacaaggagagaaaggcgccaagggggat
cccggtgctgtgggcgccccgggaaagacaggccccgtgggtcctgcaggcccggcagga
aaacctggtcctgatggtctgcgggggctcccgggctcagtgggtcagcaaggccgtcct
ggggccacgggccaggccgggcctccaggtcctgtgggacccccagggcttcctggtctc
cggggcgatactggggccaagggagagaagggtcacccaggtctcatcgggctgatcggc
ccccctggggagcagggagagaagggcgatcgaggacttcctgggcctcagggatccact
ggacagaagggagagacaggcatcccaggagcatctggccctattggtcctggagggccc
cccggcctccctggacctgctggccccaaaggagccaaaggagccacgggcccggccgga
cccaagggagagaagggcgtccagggccctccaggccacccaggccccccaggcgaggtg
atccagcccctgcccatccagatgcccaagaagacgcggcgctcagtggacggcagccgt
ctgatgcaggaagatgaggccatgccgactgggggtgccccgggcagtcccggggggctg
gaggagatctttggctcactggactcccttcgggaggagattgagcagatgaggcggccc
acggggacccaggacagcccagctcgcacctgccaggacctgaagctctgccatccagag
ctccctgacggagagtactgggtggaccccaaccagggctgtgcccgcgatgccttccgg
gttttctgcaactttactgcaggaggggaaacctgtgtgacgcccagggatgacgtcacg
cagttctcctacgtggactccgaaggctccccggtgggtgtggtccagctcaccttcctg
cggctgctcagcgtctctgcccaccaggatgtgtcctacccgtgctcctccggggaggat
caggatggccccctgaagctccggggggccaacgaggatgagctgagtccagagaccagc
ccctatgtcaaggaattcagggacggctgtcagacacagcaaggccggacggtgctagaa
gttcgaacacctgtgctggagcagctgccagtgctggacgcctccttctcagacctgggg
gcacccccgaggcggggaggggtgctgctggggcctgtctgcttcatgggctag

DBGET integrated database retrieval system