KEGG   Sus scrofa (pig): 100521003Help
Entry
100521003         CDS       T01009                                 

Gene name
GPER1
Definition
(RefSeq) G-protein coupled estrogen receptor 1
  KO
K04246  G-protein coupled estrogen receptor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04915  Estrogen signaling pathway
ssc04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100521003 (GPER1)
   04915 Estrogen signaling pathway
    100521003 (GPER1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100521003 (GPER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100521003 (GPER1)
G protein-coupled receptors [BR:ssc04030]
 Rhodopsin family
  Others
   Estrogen
    100521003 (GPER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF621
Motif
Other DBs
NCBI-GeneID: 100521003
NCBI-ProteinID: XP_003124292
Ensembl: ENSSSCG00000026422
UniProt: I3LSZ2
Position
3
AA seq 360 aa AA seqDB search
METQPGAFNGTPAAAAAGLGLDLPGALANRSAALSEHQQYVIGLFLSCVYTAVLFPIGFV
GNLLILVVNIRFREKMTVPDLYFINLAAADLVLVADSLIEVFNLDEQYYDMAALCTFMAL
FLQVNMYSSVFFLTWMSFDRYLALAQALRCGPLRTKPRARLSCGLIWMASVSATLVPFTA
VHLQHGEEACFCFADVREVQWLEVTLGFVVPFAIIGLCYSLIVRVLVTAHKHRGLRPRRH
KALRMILAVVLVFFVCWLPENVFLSVHLLQRAPPGAGPCQQSLRHAHPLAGHVVNLAAFS
NSCLNPLVYSFLGETFRDKLRLYLQQTASVSALSRFGHAALKAVVPDSTEASDGKVGSAV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcagccgggcgccttcaacggcacgcccgccgccgccgccgccggcctgggc
ctcgacctgcccggcgcgctggccaaccgctcggccgcactctcggagcaccagcagtac
gtcatcggcctcttcctgtcctgcgtctacacggccgtcctcttccccatcggcttcgtg
ggcaacctcctgatcctggtggtgaacatccgcttccgcgagaagatgacggtgcccgac
ctgtacttcatcaacctggcggcggccgacctggtgctggtggcggactcgctcatcgag
gtgttcaacctggacgagcagtactacgacatggccgcgctctgcaccttcatggcgctc
ttcctgcaggtcaacatgtacagcagcgtcttcttcctcacctggatgagcttcgaccgc
tacctggcgctggcccaggccctgcgctgcggcccgctccgcaccaagccgcgcgcccgg
ctgagctgcggcctcatctggatggcctccgtgtccgccacgctggtgcccttcaccgcc
gtgcacctgcagcacggcgaggaggcctgcttctgcttcgccgacgtccgggaggtgcag
tggctggaggtcacgctgggcttcgtggtccccttcgccatcatcggcctctgctactcg
ctcatcgtgcgcgtgctcgtgacggcgcacaagcaccgcggcctgcgcccgcggaggcac
aaggcgctgcgcatgatcctggccgtggtcctggtcttcttcgtctgctggctgcccgag
aacgtcttcctcagcgtgcacctgctgcagcgcgcgccgcccggggccggcccctgccag
cagtccctccgccacgcccaccccctggccggccacgtggtcaacctggcggccttctcc
aacagctgcctgaacccgctggtctacagcttcctcggggagaccttccgcgacaagctg
cggctgtacctgcagcagacggccagcgtgtcggccctgagccgcttcggccacgcggcc
ctgaaggcggtcgtccccgacagcaccgaagcgtccgacgggaaggtgggcagcgccgtg
tag

DBGET integrated database retrieval system