KEGG   Sus scrofa (pig): 100521069
Entry
100521069         CDS       T01009                                 

Definition
(RefSeq) zinc finger protein 709-like
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-met zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 100521069
NCBI-ProteinID: XP_003354140
Ensembl: ENSSSCG00000022634
UniProt: I3L9I4
Position
2
AA seq 523 aa
MDSVVFEDVAVNFTLEEWALLAPSEKKLYRYVMQETFRNLASIGKTWEDHDIEDQHKNQG
SKLRSHMVEAFCANKESSPCGRNLSLIPSLSLKKKATGVKPHECSACGEVFMHHSSLNRH
MRCHTEPKPYEYQKYGEKPYKCKICGKAFRYLQCFKKHERNHNGEKIYKCEECEKVFICF
SSLHVHGRSHTEEKHHQCKQFGRVYRYQRHGRTGTVEKFYECKQCGRAYISLRGLKIHER
NHTGEKPYQCNLCGKTFSSHLGFKIHERNHSGEKPYECKKCTKAFSCPSSLRRHERIHTG
EKPYQCKACGKVYRYHSSLQTHERTHTGEKPYECKACGKAFTSLSSFRAHTITHTGEGPY
KCKECEKTFLSPSSFQIHERSHTGEKPYECKQCGKAFSYFYSLQSHRRTHTGEKPYKCKI
CGKGFSCSSYVQVHERIHTGEKPFECNECGKAFICHTNFQRHVRLHTGEKPYRCEECGKA
FSCPSSFRKHKRSHWINNLEGKQHQKRLELAPSLHVKTFMEKK
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggactcagtagtctttgaggatgtggctgtgaacttcaccctggaagagtgggcttta
ctggctccttcggagaagaaactctacagatatgtgatgcaggaaaccttcaggaatctg
gcctcaatagggaaaacatgggaagatcatgatattgaagatcagcacaaaaaccaaggg
agtaaactaagaagccacatggttgaggcattctgtgcaaataaagagagtagtccatgt
ggaagaaacttgagtcttattccaagtctaagtctgaagaagaaagctactggagtgaaa
ccacatgaatgcagtgcatgtggagaagtattcatgcatcattcatcccttaatagacac
atgagatgtcacacggaacctaaaccatatgagtatcagaaatatggagagaagccatat
aaatgtaagatatgtgggaaagcattccgctatctccagtgttttaaaaaacatgaaaga
aaccacaatggagagaaaatttataaatgtgaggaatgtgagaaagtcttcatttgtttc
agttcccttcacgtgcatggaagaagtcacactgaagagaaacaccatcagtgtaaacaa
tttggaagagtctataggtatcaaagacatggcagaactggcacagtagagaaattttat
gaatgtaagcaatgtggtagggcctatatttcccttcgaggtttaaaaatacatgaaaga
aatcacactggagaaaaaccctatcaatgtaacttatgtggtaaaactttcagttctcat
ctgggtttcaaaatacatgaaagaaatcacagtggagagaaaccgtatgaatgtaaaaaa
tgtaccaaagcattcagttgccccagttctcttcgaagacatgaaagaattcatactggg
gagaaaccctatcagtgtaaggcatgcggcaaagtctacagatatcatagttccttacaa
acacatgaaaggacccacacaggagagaaaccctatgaatgtaaggcatgtgggaaagcc
tttacttctctttcaagcttccgagcacacacaatcactcacactggagaaggaccttat
aaatgtaaggagtgtgagaaaacattcctttctcccagttcatttcaaatacatgaaagg
agtcatactggagagaaaccctatgaatgtaaacagtgtggtaaagctttcagttatttc
tattccttacaatcacacagaagaactcacactggagaaaaaccttataaatgtaaaata
tgtggcaaaggcttcagttgttccagttatgttcaagtacatgagagaattcatactgga
gagaaaccctttgaatgtaatgaatgtgggaaagccttcatttgtcacacaaattttcag
agacatgtgagactgcatactggagagaaaccatatagatgtgaagaatgtgggaaagcc
tttagttgtcccagttccttccgaaagcataaaaggagccactggataaataatcttgaa
ggtaaacagcatcagaaaagacttgagctggctccatccttacatgttaaaactttcatg
gaaaagaaataa

DBGET integrated database retrieval system