KEGG   Sus scrofa (pig): 100521142
Entry
100521142         CDS       T01009                                 

Gene name
CROT
Definition
(RefSeq) peroxisomal carnitine O-octanoyltransferase
  KO
K05940  carnitine O-octanoyltransferase [EC:2.3.1.137]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100521142 (CROT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.137  carnitine O-octanoyltransferase
     100521142 (CROT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 100521142
NCBI-ProteinID: NP_001230146
Ensembl: ENSSSCG00000015391
UniProt: A0A287B7Y5
Position
9
AA seq 612 aa
MESQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANEEEYKKTEAIVQKFQN
GIGEKLQKKLLERAKGKRNWLEEWWLNVAYLDVRTPSQLNVNFAGPAPHIENYWPPKEGT
QLERGSICLWHVLNYWQLLRKEKIPVQKVGNTPLDMYQFRMLFATCKVPGITRDSVMNYF
RTESEGYCPTHVAVLCRGRVFIFDVMHKGCLVTPPEILRQLTFVQKKCHSEPDGPGIAAL
TSEERTRWAKAREYLIRLNPENLTLLEKIESSLLVYSLEDGSPHVTPEDYSQVTAEILTG
NPTVRWGDKSYNLISFSNGVFGCSCDHSPFDAMVMVNLSHYIDQKVLENEGRWKGSEKVR
EIPLPEELVFTVDEKVLNDINQAKAQYFMQASDLQLVVYAFTSFGKKQTKKKQLHPDAFI
QLALQLGYYRLHGRPGCCYETAMTRYFYHGRTETMRSCTVEAVSWCQSMQDPSTSLSERQ
HKMLEAFAKHNKMMKDCSAGKGFDRHLLGLSLIAKEEGLPVPELFTDPLFSRSGGGGNFV
LSTSLVGYFRIQGAVVPMVHNGYGFFYHIRDDRFLVSCTAWKSCPETDAEKLVQQVFCAF
HDMMQLMNIAKL
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggaaagtcaattggctaaatcaactgaagaacggacgtttcagtaccaggattctctt
ccatcactgcctgttccttcgcttgaggaatcattaaaaaaataccttgaatcagtaaag
ccatttgccaatgaagaagagtataagaaaactgaagcaattgtccaaaaatttcaaaat
ggtattggagaaaaattgcagaagaaattactcgaaagggcaaaagggaaacgaaattgg
ttggaagagtggtggctgaatgttgcctacctggatgttcgtacaccgtcacaactgaat
gtcaactttgcgggtcctgcgccccatattgaaaactactggcctccaaaggaaggcact
caactggaaagaggaagtatatgtctttggcatgtcttgaactactggcagctattaaga
aaagaaaaaatacctgtccaaaaagttggaaatactcctctagatatgtatcaattccgg
atgctgtttgccacctgcaaggttccaggaatcactagagattcagttatgaattatttt
aggactgagagtgaagggtattgtccaactcacgttgctgtgctgtgtcgaggtcgagtt
tttatcttcgatgtaatgcacaaaggatgtttggtcaccccaccagagattctcaggcag
ttgacatttgtccaaaagaagtgccacagtgaacccgatggaccaggaatagcagcgcta
actagcgaggagcgaactcgatgggctaaggcacgagagtatttgattagacttaatcca
gagaacttgactctgttagaaaaaattgagagcagtttactggtatattccttagaggat
ggcagtccacatgtaacaccagaagattattctcaggtaactgcagagattcttactgga
aatccaacagtacgctggggtgacaaatcttataacttgatttccttttctaatggagta
tttggctgtagttgtgatcattctccttttgatgcgatggttatggtaaacctcagccat
tatattgatcagaaagttttggagaacgaaggaagatggaagggttcagaaaaagtacga
gaaataccacttccagaggagcttgttttcactgtggatgaaaaagtattaaacgacatc
aaccaagctaaagcccagtatttcatgcaggcatctgacctgcagcttgtggtgtatgcc
tttacatcttttggcaaaaagcaaaccaagaagaagcagcttcaccctgatgcgtttatt
cagctggcacttcagctgggctattatagacttcatggacgccctggttgctgctatgaa
acagctatgacaagatacttttatcatggccgtacagaaaccatgcggtcatgtacagta
gaagcagttagttggtgccagtccatgcaggatccttctaccagtctttctgagcggcag
cacaagatgttagaagcttttgcaaaacataataaaatgatgaaagattgttcagctgga
aaaggatttgaccgtcatcttttaggtctgtcactcatagcaaaagaggaaggtcttcct
gttccagaactctttacagacccacttttctccagaagtggaggaggtggaaactttgtc
ctctcaacaagtctggttggttattttagaatccagggagcagtggttccaatggtacac
aatggctatggatttttctatcacatcagagatgacagatttcttgtgtcctgtacagcc
tggaaatcatgtccggaaactgatgcagaaaagctagttcagcaggttttttgtgctttc
catgatatgatgcagctgatgaacattgctaagctttag

DBGET integrated database retrieval system