KEGG   Sus scrofa (pig): 100521224Help
Entry
100521224         CDS       T01009                                 

Gene name
NEFL
Definition
(RefSeq) neurofilament light polypeptide
  KO
K04572  neurofilament light polypeptide
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100521224 (NEFL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100521224 (NEFL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100521224 (NEFL)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100521224 (NEFL)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type IV
     100521224 (NEFL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head TPR_MLP1_2 DUF1664 Lectin_N
Motif
Other DBs
NCBI-GeneID: 100521224
NCBI-ProteinID: NP_001231260
Ensembl: ENSSSCG00000009649
UniProt: F1RJU4 A0A4X1VDT6
Position
14
AA seq 552 aa AA seqDB search
MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQY
AQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVR
AAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELR
TTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSLTTGYSQSSQVF
GRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEE
GKEKEEAEAEAEAEEEEGAQEEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKDE
GAGEEQATKKKD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagttccttcagctacgagccgtactactcgacctcctacaaacgccgctatgtggag
acgccccgggtgcacatctccagcgtgcgcagcggctacagcaccgcgcgctctgcttac
tccagctactccgcgcccgtctcctcctcgctgtccgtgcgccgcagctactcctccagc
tccggctccttgatgcccagtctcgagaacctcgacctgagccaggtagccgccatcagc
aacgacctcaagtcgatccgcacacaggagaaggcgcagctgcaggacctcaacgaccgc
tttgccagcttcatcgagcgcgtgcacgagttggagcagcagaacaaggtcctggaagcc
gagctgctggtgctgcgccagaagcactccgagccgtcccgcttccgggcgctgtacgag
caggagatccgtgacctgcgcctggcggcggaagacgccaccaacgagaagcaggcgctc
cagggcgagcgcgaggggctggaggagactctgcgcaacctgcaagcgcgctacgaagag
gaggtgctgagccgcgaggacgccgagggccggctgatggaagcgcgcaaaggggccgac
gaggcggctctcgcccgcgccgagctcgaaaagcgcattgacagtctgatggacgaaatc
gcctttctgaagaaagtgcacgaagaggagatcgccgagctgcaggctcagatccagtac
gcgcagatctccgtggagatggatgtgtcctccaagcccgacctctccgccgcgctcaag
gacatccgcgcccagtatgagaagctggccgccaagaacatgcagaacgccgaagagtgg
ttcaagagccgcttcacggtgctgaccgagagcgccgccaagaacaccgatgcggtgcgc
gcagccaaggacgaggtgtccgagagccgccgactgctcaaggccaagaccctggagatc
gaagcctgccggggcatgaacgaagcgctggagaagcagctgcaggagctggaggacaag
cagaacgccgacattagtgctatgcaggacacaattaacaaattagaaaacgaactgaga
accacaaagagtgaaatggcaagatacctgaaggaataccaagaccttctcaatgtgaag
atggctttggacattgagattgcagcttacaggaaactcttggaaggtgaggagacccgg
ctgagtttcaccagcgtgggaagcttaaccactggctactctcagagctcccaggtcttt
ggccgatctgcctatggcggtttacagaccagctcctacctgatgtccacccgctccttc
ccatcatactacaccagccacgtccaggaggagcagatcgaggtggaggagaccattgag
gctgcgaaagctgaggaagccaaggacgaacctccctctgaaggagaagccgaggaggag
ggcaaggagaaggaagaagctgaggcagaggctgaggctgaggaagaggaaggtgcccaa
gaagaagaagaagaagctgccaaggaagaatctgaggaagcaaaggaggaagaagaagga
ggtgaaggcgaagaaggagaagaaaccaaagaagccgaggaggaggagaaaaaagatgaa
ggtgctggggaggagcaagcaactaagaagaaagattga

DBGET integrated database retrieval system