KEGG   Sus scrofa (pig): 100521487
Entry
100521487         CDS       T01009                                 

Gene name
WEE1
Definition
(RefSeq) wee1-like protein kinase isoform X1
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100521487 (WEE1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100521487 (WEE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100521487 (WEE1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100521487 (WEE1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100521487 (WEE1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  WEE family
   100521487 (WEE1)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100521487 (WEE1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 100521487
NCBI-ProteinID: XP_003123030
Ensembl: ENSSSCG00000013411
UniProt: F1S6U8 A0A4X1TU94
Position
2
AA seq 646 aa
MSFLSRQQPPPPRRAGASCTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEAGPERRRSPGPAPGSPGELEEDLLLRGACSGADAAGGGAEGDSWEEEGFG
SSSPVKSPAAAYFLGSSFSPVRCGGPGDASPRGCATRRAAEGPCSPLPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSNSVKLRGGSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSVLLHSSGQCRRRKRTYWNDSCGEDMEASDYEFEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRRMSYFTEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagcttcctgagccggcagcagccgccgccgccccgccgcgctggggcctcctgcacc
ttgcggcagaaactgatcttctcgccctgcagcgactgtgaggaggaggaggaagaagag
gaggaagaaggcagcggccacagcacaggggaggactcggcctttcaggagcccgactcg
ccgctgccgcctgcgcggagccccacagaggccgggcccgagcgccgccgctcgcccggc
ccggcccccggcagccccggggagctggaggaggacctgctgctgcggggcgcctgctcc
ggcgccgacgcggcgggcggcggggccgagggcgactcatgggaggaggagggcttcggc
tcttcgtcgccggtcaagtccccggcggccgcctactttctgggcagctcgttctcgccc
gtgcgctgtggcggcccgggggatgcgtccccgcggggctgcgcgacgcgcagggcggcc
gaggggccctgctcgccgctgcccgaccacccgggcaccccgccgcacaagaccttccgc
aagctgcggcttttcgacacgccgcatacccccaagagtttgctctctaaagctcgagga
attgattccaactctgttaaactccgtggtggttctctattcatggatacagaaaaatca
ggaaaaagggaatttgatgttcgacagactccacaagtgaatattaatccttttactcca
gattcggtgttgcttcattcctcaggacagtgtcgtagaagaaagagaacatactggaac
gattcctgtggtgaagacatggaagccagtgattatgagtttgaagatgaaaccagacct
gctaaaagaattacaattactgaaagcaatatgaagtcacggtatacaacagaatttcat
gagctagagaagattggctctggagaatttggttctgtttttaaatgtgtgaagaggctg
gatggatgcatttatgccattaagcgatcaaaaaagccattggctggctctgttgacgag
cagaacgctttgagagaagtatatgctcatgcagtgcttggacaacattctcatgtagtt
cgatatttctctgcctgggcagaagatgatcatatgcttatacagaatgaatattgtaat
ggtggaagtttagctgatgccataagtgaaaactacagaagaatgagttactttacagaa
gctgagttgaaagatctccttttgcaagttggccggggcttgaggtatattcattcaatg
tctttggttcacatggatataaagcctagtaatattttcatatctcgaacttcaatccca
aatgctgcctctgaagaaggagatgaagatgactgggcatccaacaaagttatgtttaaa
ataggtgaccttgggcatgtaacaagaatctctagtccacaagttgaagagggtgatagc
cgttttcttgcaaatgaagttttgcaggagaactatactcatctaccaaaagcggatatt
tttgcccttgccctcacagtggtatgtgctgctggtgctgagcctcttcccagaaatgga
gaccaatggcatgaaatcaggcaggggagattacctcggattccacaagtgctttctcaa
gaatttacagagttgctaaaagttatgattcatccagatccagagagaagaccttcagca
atggcactggtaaagcattcagtattgctatctgcttctaggaagagtgcagaacaatta
cgaatagaattgaatgctgaaaagttcaaaaactcacttttgcagaaagaactcaagaaa
gcccagatggcaaaagctgcagctgaggaaagggcactcttcactgaccggatggccacc
aggtccaccacccagagtaatagaacatctcgacttattggaaagaaaatgaaccgctct
gtcagccttaccatatactga

DBGET integrated database retrieval system