KEGG   Sus scrofa (pig): 100521514
Entry
100521514         CDS       T01009                                 

Gene name
GALK1
Definition
(RefSeq) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00052  Galactose metabolism
ssc00520  Amino sugar and nucleotide sugar metabolism
ssc01100  Metabolic pathways
Module
ssc_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
ssc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100521514 (GALK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100521514 (GALK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100521514 (GALK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     100521514 (GALK1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100521514 (GALK1)
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Other DBs
NCBI-GeneID: 100521514
NCBI-ProteinID: XP_003131241
Ensembl: ENSSSCG00000017203
UniProt: F1RVY7 A0A4X1UWR1
Position
12
AA seq 392 aa
MAASEQPRAEELLARARRAFLEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELV
TVLVGSPRTDGLVSLLTTSEDADEPRRLQFPLPTDKRPLEPGTPHWANYVKGVIQHYPAA
PLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQRAEHSFAGV
PCGIMDQLIALLGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLGSSEYPLRR
RQCEEVARALGKESLREVQREELEAGRELVSGEAFRRARHVVGEIQRTAQAAAALSRGDY
RAFGRLMVESHHSLRDDYEVSCPELDQLVEAALSAPGVYGSRMTGGGFGGCTVTLLEASA
ASLVMQHIQEQYSGAATFFLSQAADGAKVLHF
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggccgcttcggaacagccccgggccgaggagctgctggccagggcccggagagccttc
ctggaggagttcggggccgagcccgagctggccgtgtcggcgccgggccgcgtcaacctc
attggggagcacacggactacaaccagggcctggtgctgcccatggctctggagcttgtg
actgtgctcgtgggcagcccccggacggatgggcttgtctccctccttaccacctctgag
gatgccgatgagccccggcggctgcagtttcccctgcccacagacaagcggccgctggag
cctgggaccccgcactgggccaactatgtgaagggagtgatccagcactatccagctgcc
cccctccctggcttcagtgcagtggtggtcagctcagtgccactagggggtgggctgtcc
agctcagcatccctggaagtggccacgtataccttcctgcagcagctctgcccagactcg
gggacaatagctgcccgggcccaggtgtgtcagcgggccgagcacagcttcgcaggggtg
ccctgtggcatcatggaccagctcatcgcactgctggggcagaaaggccacgcgctgctc
attgactgcaggtccctggagacaagcctcgtgccgctgtcggaccccaagctggcagta
ctcatcaccaactccaatgtccgccattcactgggctccagcgagtaccccctgcggcgg
cggcagtgtgaggaagtggcccgggcgctgggcaaggagagccttcgggaggtgcagcgg
gaggagctagaagctggcagggagctggtgagtggggaggccttccggcgggcgcgacac
gtcgtgggtgagatccagcgcacagcccaggcggcggccgccctgagccgtggcgactac
agagcctttggccgcctcatggtggagagtcaccactcgctcagggacgactacgaggtg
agctgtcctgagctggatcagctggtggaggccgccctctctgcgcccggggtttatggc
agccgcatgacaggtggtggctttggtggctgcacggtgaccttgctggaggcctctgcc
gcttccctcgtgatgcagcacatccaggagcagtacagcggtgccgccaccttcttcctc
tcccaggcagccgacggtgccaaggtgctgcacttctga

DBGET integrated database retrieval system