KEGG   Sus scrofa (pig): 100521936
Entry
100521936         CDS       T01009                                 

Gene name
BANF2
Definition
(RefSeq) barrier-to-autointegration factor-like protein
  KO
K21870  barrier-to-autointegration factor
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100521936 (BANF2)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    100521936 (BANF2)
SSDB
Motif
Pfam: BAF
Other DBs
NCBI-GeneID: 100521936
NCBI-ProteinID: XP_003134313
Ensembl: ENSSSCG00000007087
UniProt: A0A4X1UV79 A0A287A3L7
Position
17
AA seq 90 aa
MDHMSPRLRAFLSEPIGEKDVAWIAGISRELAINLVTKGFNKAYILLGQFLLMHKNEAEF
QKWLICCCGATECEAQESSNCLKEWCSCFL
NT seq 273 nt   +upstreamnt  +downstreamnt
atggaccacatgtctcccaggctgagagccttcctctctgaacccataggagaaaaagat
gtcgcctggatagccgggatcagccgtgagcttgcaatcaatttggtcaccaaaggtttc
aacaaggcctacatcctgttgggacagttccttctgatgcacaagaacgaagccgagttt
cagaagtggctcatttgctgctgtggggccaccgagtgtgaggcccaggagagctccaac
tgtctgaaagagtggtgttcctgcttcctgtag

DBGET integrated database retrieval system