KEGG   Sus scrofa (pig): 100521974Help
Entry
100521974         CDS       T01009                                 

Gene name
FBXO42
Definition
(RefSeq) F-box only protein 42
  KO
K10317  F-box protein 42
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100521974 (FBXO42)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100521974 (FBXO42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_4 Kelch_3 Kelch_5 Kelch_2 Kelch_1 Kelch_6 F-box-like F-box F-box_5
Motif
Other DBs
NCBI-GeneID: 100521974
NCBI-ProteinID: XP_003127683
Ensembl: ENSSSCG00000024794
UniProt: F1SUS5
Position
6
AA seq 717 aa AA seqDB search
MASSSDSEDDSFMAVDQEETVLEGTMEQDEEPHPVLEAEETRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFIKAVQEGNIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEDHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRNMDEAPCVNGRWGTLRPRAQRQTP
SSSREGSLSPARGDGSPILNGGSLSPGSAAVGGSSLDSPVQAISPSTPSTTEGYDLKMGL
SLAPRRGSLPDQKDLRLGSIDLNWDLKPASTSNHMDGVDNRTVGGSMRHPPEQTNGVHTP
PHVASALAGAVSPSALRRSLEAIKAMSSKGPPASAALSPPLGSSPGSPGSQNLSSGETVP
VPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRV
KWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggccagctcctcggacagtgaagatgacagtttcatggctgtggaccaagaagaaact
gtgttggaagggacaatggagcaagatgaggagccccacccagtattggaggctgaggag
actagacataataggtccatgtctgagctgccagaagaggttttggagtatatactatcc
tttctttcaccttaccaagaacacaaaactgcagcccttgtctgcaaacagtggtatcga
cttattaaaggtgtagcccaccagtgttatcatggtttcataaaggctgttcaggaagga
aacattcagtgggagagtcggacttacccttatcctggaaccccaatcactcagcggttc
tcacacagtgcatgctattatgatgctaatcagtctatgtatgtgtttggaggctgtacc
cagagcagctgcaatgctgccttcaatgacctctggagactcgacctaaatagcaaagag
tggatccgacctttagcttcagggtcctatccttcccccaaagctggagcgactctggtt
gtatacaaggacctgctggtgctgttcggtggctggactcggccaagcccttatccccta
caccaaccagagagattctttgatgaaatacatacttactcaccctctaaaaattggtgg
aactgcattgtgacgactcatggcccacctcccatggccgggcattcgtcttgtgtgata
gatgataaaatgattgtctttggtggctccctaggatcccggcaaatgagcaatgatgtc
tgggtccttgacctcgagcagtgggcgtggtccaagccgaacatctctggccccagtcct
catcctcgaggtggccaatctcagattgtcatagatgatgcaactatcttaatccttggg
ggatgtggcggtcctaatgctctgttcaaagatgcttggttgttgcacatgcactcaggt
ccctgggcctggcagccactcaaggtagaaaatgaagatcatggggccccagaactgtgg
tgccatccagcttgccgggtagggcaatgtgtggtggtcttcagccaggctcctagtggg
agagccccactcagccccagtttgaactctcgcccatcacccatcagtgccactcctcca
gccctggttcccgaaacccgagaataccgttctcagtctccagtaaggaatatggatgaa
gctccctgtgttaatggtcgctggggaacactgaggcccagagctcaaaggcagaccccc
tcaagttcccgagaaggaagcctctctccagccagaggagatggctctcccatcctcaat
ggtgggagcttatctccaggatcagcagctgtaggtggctcttccttggacagccctgta
caggctatatctcctagcactccatctaccaccgaaggatatgacctaaaaatgggactt
tctttggcccccagacgagggtcactaccagaccagaaagatctaagattaggatcaata
gatctgaattgggatctgaaaccggcttccactagcaatcatatggatggtgtggacaac
aggacagttggaggaagtatgagacaccctcccgaacagacaaatggtgtgcatacccca
ccccatgtggccagtgccctcgctggagccgtttccccaagcgccctgcgtcggagccta
gaagccatcaaagcaatgtcatccaaaggcccaccagcctccgcagcactaagtcctcct
ctgggctcttctccaggctcccctgggagccagaacctgagcagtggagaaacagtaccc
gttccccgcccagggcctgcccaaggagatggacattccttacctcccatcgcccgccgc
ctggggcaccaccctccacagtccctaaatgttggcaaacctttgtaccagagtatgaac
tgcaagcccatgcagatgtacgtgctggacattaaagacaccaaggagaaggggcgagtc
aaatggaaagtatttaatagcagttctgtggttggacctcctgaaactagcctgcataca
gtggtacaaggcaggggtgaactcatcatatttggaggactcatggacaagaaacagaat
gtgaagtactatccaaaaacaaacgccttgtactttgtgcgagcaaagagataa

DBGET integrated database retrieval system