KEGG   Sus scrofa (pig): 100521982Help
Entry
100521982         CDS       T01009                                 

Gene name
ANXA5
Definition
(RefSeq) annexin A5
  KO
K16646  annexin A5
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100521982 (ANXA5)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100521982 (ANXA5)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100521982 (ANXA5)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Haparin
  Others
   100521982 (ANXA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 100521982
NCBI-ProteinID: XP_003129266
Ensembl: ENSSSCG00000009097
UniProt: F2Z5C1 A0A287A531 A0A4X1VBD0
Position
8
AA seq 321 aa AA seqDB search
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEIAVAFKTL
FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKILTEIIASRTPE
ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDGRIDEAQVEQDAQALF
QAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAV
VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI
KGDTSGDYKKALLLLCGGEDD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggttctcagaggcactgtgactgacttccctggatttgatgagcgggctgat
gcagaaactcttcggaaggccatgaaaggcctgggcactgacgaggagagcatcctgact
ctgttgacctcccgcagtaatgctcagcgccaggagatcgctgtggcttttaaaactctc
tttggcagggaccttctggatgacctgaaatcagagctgactggaaaatttgaaaaatta
atcgtggctttgatgaaaccttctcggctgtacgatgcctatgaactgaagcatgctctt
aagggagctgggacagatgagaaaatcctgacagaaattattgcttcaaggacacctgaa
gaattaagagccataaaacaagtttatgaagaagaatatggctcaagcctggaagatgat
gtggtgggagatacatcagggtactaccagaggatgctggtggtcctccttcaggctaat
agagatcctgatggtagaattgatgaagcacaggttgaacaagatgctcaggcattgttt
caggctggagaacttaaatggggaacagatgaagaaaagtttattactatctttggaaca
cgaagtgtgtcacatttgagaagggtgtttgacaaatacatgactatatcaggatttcaa
attgaagaaaccattgaccgggagacttctggtaatttggagcaactgctccttgctgtt
gtgaaatctattcggagtatccctgcctaccttgcagaaactctctactatgcaatgaag
ggagctgggacagatgatcataccctcatcagagtcatggtttccaggagtgagattgat
ctgtttaacattaggaaggagtttaggaagaattttgccacctctctttattccatgatt
aagggtgacacatctggggactataagaaggccctcctgctgctctgtggaggcgaagat
gactga

DBGET integrated database retrieval system