KEGG   Sus scrofa (pig): 100522004
Entry
100522004         CDS       T01009                                 

Gene name
SF3B2
Definition
(RefSeq) splicing factor 3B subunit 2 isoform X2
  KO
K12829  splicing factor 3B subunit 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100522004 (SF3B2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ssc03041]
    100522004 (SF3B2)
Spliceosome [BR:ssc03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    100522004 (SF3B2)
 Complex B
    100522004 (SF3B2)
 Complex C
   U2 SnRNP specific factors
    100522004 (SF3B2)
SSDB
Motif
Pfam: DUF382 PSP SAP
Other DBs
NCBI-GeneID: 100522004
NCBI-ProteinID: XP_003122553
Ensembl: ENSSSCG00000012957
UniProt: F1RU38
Position
2
AA seq 895 aa
MAAEHPEPPKGELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGSREELVERLQTYTRQ
TGIVLSRPVLRGEDGDKAAPPPMSAQLSGIPMPPPPMGLPPLQPPPPPPPPPPGLGLGFP
MAVGPRPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHEL
LEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDLGQIGVRPPLGARVAAPVGPTPTVLPMG
APVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQDEEEMETDT
RSSLGPSASETEEDSVSVSKKEKNRKRRNRKKKKKPQRVRGLSSESSGDREKESSRSRGS
DSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAVPK
KKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDV
TAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREAL
QEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETR
LKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPES
CSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSE
EEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSET
PQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAM
TQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
NT seq 2688 nt   +upstreamnt  +downstreamnt
atggcggccgagcatcccgagcctccgaaaggagagttgcagctgccgccgccgccgcct
cctgggcattatggtgcctgggctgctcaggagcttcaggccaaattagcggagatcggc
gctccaatccaggggagtcgcgaggagctggtggaaaggctgcagacctacacccgccag
actggcatcgtcctgagtcggcctgttctgagaggtgaagatggggacaaagctgctccc
cctcctatgtcagcccagctctctgggattcccatgccacccccgcccatgggactcccc
cctctacagcctcctccaccacccccaccacctccacctggccttggccttggctttccc
atggcagttggaccccgccctccaaacttgggcccccctcctcctctccgagtgggtgaa
cctgtggcactgtccgaggaagagcggttaaagctggcgcagcagcaggcggcattgctg
atgcagcaagaggaacgtgccaagcagcagggggatcattcactgaaggaacatgagctt
ttggagcagcagaagcgggcagccgtgttactggagcaggaacggcagcaggagattgcc
aagatgggcaccccagtccctcggcccccacaggacttgggccagattggtgttcgccct
cctctgggtgctcgagtagctgccccggtgggccccactcccactgttttgcctatgggg
gcccctgttcctcggcctcgtggtcccccaccaccccctggagatgagaacagagagatg
gacgacccctctgtgggccccaagatcccccaggctttggaaaagatcctgcagctgaag
gagagccgccaggaagagatgaactctcagcaggacgaggaggagatggaaacagacacg
cgctcgtccctgggcccgtcggcgtcagagaccgaggaggacagcgtgtccgtgtccaaa
aaagagaaaaaccggaagcgtcggaaccgaaagaagaagaaaaagccccagcgggtgcgg
gggctgtcgtcggagagctccggggaccgagagaaggagtccagccggtcccgtggctcc
gactcgcccgcggccgatgttgaaattgagtacgtgaccgaagagcctgaaatttacgag
cccaacttcatcttcttcaagaggatctttgaggctttcaagctcaccgatgacgtgaag
aaggagaaagagaaggagccagagaagctcgacaaactggagaactctgcggtgcccaag
aagaagggctttgaggaggagcacaaggacagcgacgatgacagcagcgatgacgaacag
gagaagaagccagaagcccctaagttgtccaagaagaagctgcgcagaatgaatcgcttc
actgtggctgaactcaagcagcttgtggctcggcctgatgttgtggagatgcatgacgtg
acggcccaggaccccaagctcttggttcacctcaaggccacgcggaattctgtgcctgtg
ccccgccactggtgttttaagcgcaagtacctgcagggcaaacgaggcatcgagaagccc
cccttcgagctgccagatttcatcaaacgcacaggcatccaggagatgcgggaggccctg
caggagaaggaggagcagaagaccatgaagtccaagatgcgagagaaggtccggcccaag
atgggcaagatcgacatcgactaccagaagctgcacgacgccttcttcaagtggcagacc
aagcccaagctgaccatccacggggacctgtactacgaggggaaggagtttgagacacgg
ctgaaggagaagaagccaggcgatttgtctgatgagctgcggatttccttggggatgcca
gtaggaccaaacgcacacaaggtccctcccccgtggctgatcgccatgcagcgctacggg
ccgcccccgtcgtaccccaacctgaagatcccggggctgaactcgcccatccccgagagc
tgttccttcgggtaccatgctggtggctggggcaaacccccagtcgatgagaccgggaaa
cccctctatggggatgtgtttggaaccaatgctgctgaatttcagaccaagactgaggaa
gaggagattgatcggaccccttggggggagctggagccgtcggatgaagaatcttcagaa
gaagaggaagaggaggagagcgatgaagacaagccggatgagacaggcttcatcacccct
gcagacagcggcctcatcactcccggaggcttctcgtccgtgccggcaggaatggagacc
cctgaactcattgagctgaggaagaagaagattgaggaggcgatggacggaagtgagaca
ccgcagctcttcactgtgttgccggagaagagaacagccaccgttggaggggccatgatg
ggatcgacccacatctatgacatgtccacggttatgagccggaagggcccagcccccgag
ctgcaaggtgtggaagtggccctggcacccgaagagttggagctggatcccatggccatg
acccagaagtatgaggagcacgtgcgggagcagcaggcccaagtggagaaagaggacttc
agcgacatggtggctgagcatgctgccaagcagaagcaaaagaaacggaaagctcagccc
caggacagccgtgggggcagcaagaaatataaggagttcaaattttag

DBGET integrated database retrieval system