KEGG   Sus scrofa (pig): 100522066Help
Entry
100522066         CDS       T01009                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04260  Cardiac muscle contraction
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04921  Oxytocin signaling pathway
ssc05410  Hypertrophic cardiomyopathy (HCM)
ssc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ssc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100522066 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100522066 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100522066 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    100522066 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100522066 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100522066 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    100522066 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100522066 (CACNG3)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100522066 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 100522066
NCBI-ProteinID: XP_003124590
Ensembl: ENSSSCG00000007831
UniProt: A0A287AXU2
Position
3
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggaatccagatgttgatcaccactgtgggagccttcgcagct
tttagtctaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tcggggctgtggaggacctgctgcctagaaggggcgttccgaggtgtgtgcaagaaaatc
gatcacttccctgaagatgctgactacgaacaggacacggctgaatatctcctgcgggct
gtgagggcctccagcgtcttccccatcctcagtgtcacgctgctcttcttcggcgggctc
tgcgtggcagccagcgagtttcaccgcagcagacacaacgtcatcctcagcgcaggcatc
ttttttgtctctgcagggttaagcaacatcatcggcatcatagtttatatctcagccaat
gctggagaccccgggcagcgtgactccaaaaagagctactcctatggctggtccttttat
ttcggagccttctcttttatcattgcggaaattgtgggcgtggttgccgtgcacatctat
atagaaaaacatcagcagttacgtgccaaatcccactcggagctcctgaagaaatccacc
ttcgcgcgccttccaccctacaggtatcgattccggaggcggtcaagttcccgctccacg
gagcccagatcccgagacctgtcccccatcagcaaaggcttccacaccatcccttccacc
gacatctcaatgttcaccctctcccgggacccctccaagatcaccatggggaccctcctc
aactctgaccgggaccatgcttttctacagttccacaattccacacccaaagagttcaaa
gagtcattgcataataatccggccaacaggcgcaccacgcccgtctga

DBGET integrated database retrieval system