KEGG   Sus scrofa (pig): 100522091Help
Entry
100522091         CDS       T01009                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00230  Purine metabolism
ssc01100  Metabolic pathways
ssc04022  cGMP-PKG signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04540  Gap junction
ssc04611  Platelet activation
ssc04713  Circadian entrainment
ssc04730  Long-term depression
ssc04921  Oxytocin signaling pathway
ssc04924  Renin secretion
ssc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100522091 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100522091 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100522091 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100522091 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100522091 (GUCY1A2)
   04924 Renin secretion
    100522091 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100522091 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    100522091 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    100522091 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100522091 (GUCY1A2)
Enzymes [BR:ssc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100522091 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB GST_C_3 Rx_N
Motif
Other DBs
NCBI-GeneID: 100522091
NCBI-ProteinID: XP_003130141
UniProt: A0A4X1V6P0 I3L9I5
Position
9
AA seq 735 aa AA seqDB search
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSAAAAAAPAPAS
STIAAAAAAATAASSTAGARRTQRRRRVNLDSLGESISRLTAPSPQMIQQTLKRTLQYYE
HQVTGYRDAEKNFYNISNRCSYADHSNKEDIEEVLGILQCTANVLGLKFEEIQERFGEEF
FNICFDENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLML
HYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVDQVANEKLCSDGSNPGNCSCLSFLIKQCE
NTNITKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPHMSVLQLGEGLRKQLRCDTHKV
LMFEDCFEIVSPKINATFERVLLRLSTPFVIRTKPEASGTENKEKVMEVKGQMIHVPESN
SILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLE
RTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQC
TPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMM
ELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRIN
VSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKQPKPSLSSSRIKK
VSYNIGTMFLRETSL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtccgagtccttcagctccctgggctctgactacctggag
accagcccggaagaggagggggagtgccccttgtctaggctctgctggaacggcagccgc
agcccgccagggcctctggagcccagcgcggcggctgccgccgccccggccccggcatcc
tccaccattgccgctgccgctgccgctgccaccgccgccagctccacggcaggggctagg
agaacgcagcgccggaggcgggtcaacctggactcgctgggtgagagcatcagccgcctg
acggcgccctcgccccagatgatacagcagactcttaagaggacattgcagtattatgag
caccaagttactggttatagggatgcagaaaagaatttctacaatatctctaacagatgc
tcctatgcagaccattccaacaaagaggacattgaagaggtcttgggaattcttcagtgt
actgctaatgtactcggtttgaagtttgaggaaattcaagaaagatttggtgaggagttc
tttaatatatgcttcgatgagaatgaaagagttcttcgagctgtaggtggcacgttgcag
gacttttttaatggctttgatgctttattggaacacattagaacttcttttggaaaacag
gccactctggagtctccgtcattcctatgcaaagagctccctgaaggtactcttatgctt
cactacttccaccctcaccatattgtgggatttgcaatgcttgggatgattaaagctgca
ggaaagaagatctatcggctggatgtagaagttgatcaggttgcaaatgagaaactgtgc
tcagatggttcaaacccaggcaactgtagctgtctttctttccttatcaaacaatgtgaa
aatactaatatcacgaagaaccttccacagggaacctcccaagttcctgcagacctgaga
attagcatcaacaccttctgcagagccttccctttccacttgatgtttgacccccacatg
tcagtccttcagctgggagaaggactaaggaaacagctccgatgtgacactcacaaagtg
cttatgtttgaggactgcttcgagatcgtttctccaaagattaatgccacctttgaaagg
gtcctgctgcgactgtctactccgtttgtgatcaggaccaagcctgaggcttctggcact
gagaataaagaaaaggtgatggaagtgaaaggacaaatgatccatgtcccagaatcaaat
tccattttgttcttgggttctccatgtgtggacaagttggatgaacttatgggacgagga
ctgcatctctcggacatccctatccatgatgcgacccgagatgtcattttggttggcgag
caagcaaaggctcaggatggcttgaagaagagaatggataaattaaaagcaactttggaa
agaactcaccaggccctagaagaagagaaaaaaaagacagtggatcttctatattctatt
ttccctggtgatgtagcccagcagttgtggcaaggccagcaagtgcaggccagaaagttt
gatgatgtcaccatgctcttttcagacattgttggcttcacagccatatgtgcccagtgt
acccccatgcaggtgatcagcatgctgaatgaactgtacacaagatttgaccaccaatgt
ggatttttggatatttataaggtggaaacaataggtgatgcatactgtgttgctgcaggg
ctccacagaaaaagcctttgccatgctaaacccattgctctgatggccctgaagatgatg
gaactttcagaagaggtgctgacacctgatggaagaccaattcagatgaggataggcatt
cactcgggctctgtgctggctggagttgttggagtgagaatgccacgatactgcttgttt
ggaaataatgtcactctggcaagcaaatttgaatcgggaagtcaccctcgacgcatcaat
gtcagcccaaccacttaccagttattaaaacgagaagaaagtttcacatttattcctcga
tcccgtgaagagcttccagacaactttccaaaggaaatccctgggatctgctatttcctg
gaggtaagaactggtcctaagcagccaaaaccttctctttcttcttcaagaataaaaaag
gtttcctacaacattggcaccatgttcctccgggagacaagcctctga

DBGET integrated database retrieval system