KEGG   Sus scrofa (pig): 100522516
Entry
100522516         CDS       T01009                                 

Gene name
GLYCTK
Definition
(RefSeq) glycerate kinase
  KO
K11529  glycerate 2-kinase [EC:2.7.1.165]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00030  Pentose phosphate pathway
ssc00260  Glycine, serine and threonine metabolism
ssc00561  Glycerolipid metabolism
ssc00630  Glyoxylate and dicarboxylate metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100522516 (GLYCTK)
   00630 Glyoxylate and dicarboxylate metabolism
    100522516 (GLYCTK)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100522516 (GLYCTK)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100522516 (GLYCTK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     100522516 (GLYCTK)
SSDB
Motif
Pfam: DUF4147 MOFRL DIMCO_N
Other DBs
NCBI-GeneID: 100522516
NCBI-ProteinID: XP_003132296
Ensembl: ENSSSCG00000011432
UniProt: A0A4X1VIM6 F1SIX9
Position
13
AA seq 523 aa
MAIALQVLRHFARAPSRPLLWGCPLTRLASGMALEEQARQIFESTVGAMLPGPMLQRALS
LDPDSGQLKVRDRSFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPRGIRAAM
EHAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIRQLAEGLTADDLLLVLISGGGS
ALLPAPIPPVTLEEKQKLTKLLAARGANIQELNTIRKALSQLKGGGLAQAAYPAQVVSLI
LSDVVGDPVEVIASGPTVASVHSVQDCLHILNRYGLRAALPRSVKTVLARADSDPHGPHA
CGHVLNVIIGSNALALAEAQKQAEALGYKAVVLSTAIQGDVKNVAQFYGLLARVAGACLT
MPAAGTSVEEDKQLYELAAQLQLPDLQLKEALEAVVGAQGPVCLLAGGEPTVQLQGSGKG
GRNQELALRVGVELGQWPLEPIDVLFLSGGTDGQDGPTEAAGAWVRPELARQAVAEGLDV
AAFLAHNDSYTFFCRFQGGAHLLHTGLTGTNVMDTHLLFLRPR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctatagccctgcaagtcctgcgtcacttcgcccgggccccctcgcgcccactcctc
tgggggtgcccattgacccggctggccagtggcatggccctggaagagcaggcacggcaa
atatttgagagcactgtgggtgccatgctgccaggtcccatgctgcagcgggcactgtcc
ttggatcctgacagtgggcagctgaaagtgcgggaccggagctttcagctgcggcagaac
ctctacctggtgggctttggcaaggctgtgctgggcatggcagctgcagctgaggagcta
ctaggccaacatctcgtgcagggagtgatcagcgtgcccagggggatccgtgctgccatg
gagcatgctggcaaacaagagatgctgctgaagccccatagccgtgtccaggtattcgag
ggtgcggaggacaacctcccggaccgggatgcactgcgggccgcgctggccatccgacag
ctggccgaaggcctcacagctgatgacctgctgcttgtactcatctcaggtgggggatcg
gcgctgctgcccgcccccatcccgcctgtcacactggaggagaagcagaagctaaccaag
ctgctggcagcccgtggagccaacatccaggagctgaacaccatccggaaggccttgtcc
cagctcaagggtggggggctggctcaggctgcctaccctgctcaggtggtgagcctgatt
ctgtccgatgtggtgggagaccctgtggaggtgattgccagcggccccactgtggccagc
gtccacagtgtgcaagattgcctgcacatcctcaatcgttatggccttcgtgctgctctg
ccacgttctgtgaaaactgtgctggctcgggctgactctgacccccatggaccacatgcc
tgtggtcatgtcctcaatgtgatcattggctccaatgcactggcactggctgaagctcag
aagcaggctgaggcactgggttataaggctgtggtgctgagcacagccatacagggtgat
gtgaaaaatgtggcccagttctatgggctgctggcccgagtggctggagcctgcctcacc
atgcctgcggctggaacctctgtagaggaggataaacaactctatgaactggcggcccag
ctccagctcccagatttgcagctgaaggaggccctggaagctgtggtgggagctcagggg
ccagtttgcttgctggctggtggcgagcccacagtgcagttgcagggctcaggcaagggt
ggccggaaccaggaactggccctgcgtgttggagtggagctgggacagtggccattagag
cctattgatgtgctgtttttgagtggtggcactgatgggcaggatgggcccacagaggca
gctggggcctgggttaggcctgagcttgccagacaggccgttgccgagggtctggatgtg
gctgccttcctggcccacaatgactcatataccttcttctgccgcttccagggtggggca
catctgctgcacacggggctgacgggcactaatgtcatggatacccacctcctgttcctg
cggcctcggtga

DBGET integrated database retrieval system