KEGG   Sus scrofa (pig): 100522554
Entry
100522554         CDS       T01009                                 

Gene name
BAG2
Definition
(RefSeq) BAG family molecular chaperone regulator 2 isoform X1
  KO
K09556  BCL2-associated athanogene 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100522554 (BAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    100522554 (BAG2)
Chaperones and folding catalysts [BR:ssc03110]
 Other chaperones and cochaperones
  BAG
   100522554 (BAG2)
SSDB
Motif
Pfam: ACDC
Other DBs
NCBI-GeneID: 100522554
NCBI-ProteinID: XP_003128384
Ensembl: ENSSSCG00000001494
UniProt: A0A287AV76
Position
7
AA seq 210 aa
MAQARISAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEVLLEMI
HSIQNSQDMRQISEGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKQATRIIDEV
VSKFLDDLGNAKSHLMSLYSACSSEVPAGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGASKTLQQNTESRFN
NT seq 633 nt   +upstreamnt  +downstreamnt
atggctcaggcgaggatcagcgccaaggccaacgagggccgcttctgccgctcctcgtcc
atggccgaccgctccagccgcctgctggagagcctggaccagctggagctcagggtggaa
gctctgcgagaagcggccactgccgtggagcaggagaaggaggtgctgctggagatgatc
cacagcatccagaacagccaggacatgcggcagatcagcgaaggggaaagggaagaacta
aacctgactgcaaaccgtctgatgggacgaacactgaccgttgaagtttcggtggaaaca
attaggaacccccagcagcaggagtccctcaagcaagccaccaggatcatcgacgaagtg
gtgagcaagtttctggatgacctgggaaatgccaagagtcacctcatgtcactgtacagc
gcctgttcttccgaggtgcctgccgggcccgtggatcagaagttccagtccatagtgatt
ggctgtgctcttgaagatcagaagaaaattaagagaaggctagagaccctgcttaggaac
attgaaaactctgacaaggccatcaagctgctggagcattctaaaggggcttccaaaacc
ctgcagcagaacaccgagagcaggttcaattag

DBGET integrated database retrieval system