KEGG   Sus scrofa (pig): 100522576
Entry
100522576         CDS       T01009                                 

Gene name
MAIP1
Definition
(RefSeq) m-AAA protease-interacting protein 1, mitochondrial
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: Tim44 MBA1
Other DBs
NCBI-GeneID: 100522576
NCBI-ProteinID: XP_003133619
Ensembl: ENSSSCG00000016088 ENSSSCG00000024854
UniProt: A0A286ZYM2 A0A4X1VDL1
Position
15
AA seq 288 aa
MALAVRLLSRLLLFRPLPGWAARLQSPGSTEVRPPWPGFCCFCRRRLGSGTTPFPRVSWA
LALPARGPGRPLLSPRELPATLPAFSSCSRRTYSTEDQPQQRQKTKMIILGFPNPINWVR
TRIYSFLIWAYFDQEFSIAEFSEGAKQAFSHVSKLLSQCKFDLLEELVAKEALHVLKEKV
TSLPDNHKHALAADIDEIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETISGA
SVFQVKLGDQNMETKQLLSASYEFQREFTQGVKPDWTIARIEHPKLLE
NT seq 867 nt   +upstreamnt  +downstreamnt
atggcgctggccgtacgtcttttatcccgcttactgctatttcggcctctgcccggctgg
gccgcccgactccagagccctggttcgaccgaggtgaggccgccatggcctggattttgc
tgcttctgccgccgccgccttggttcgggaacgaccccatttcctcgagtctcttgggcc
ttggcgctgccagctcggggtcctgggcgtcccctgctcagccctcgggagctccctgca
accctccccgccttctcttcctgctctcggcgaacctacagcacggaggatcagccccag
cagcgccagaaaaccaagatgatcattctggggttccccaaccccatcaactgggttcgg
actcgaatttactccttccttatctgggcctatttcgaccaagagttcagcatcgcagaa
ttctcagagggagcgaagcaggctttttctcatgtgtccaagttgctgtcacagtgtaaa
tttgatctattggaagaactcgtggccaaagaggctctacatgtattaaaagaaaaggta
acttcattacctgacaaccataaacatgcccttgctgctgacatagatgaaattgtatac
acatctacaggcgacatctccatttactacgacgagaaaggaaggaagtttgttaacatc
ctgatgtgcttttggtatctaaccagtgccaacatccccagtgaaactataagtggagcc
agtgtgttccaggttaagttgggggatcagaacatggaaactaaacagcttcttagtgca
agctatgagtttcagagggagtttacacaaggagtaaaacctgactggaccatcgcacgg
attgaacacccaaagctattagaataa

DBGET integrated database retrieval system