KEGG   Sus scrofa (pig): 100522606
Entry
100522606         CDS       T01009                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ssc03021]
    100522606 (AFF3)
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100522606 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100522606
NCBI-ProteinID: XP_020943842
Position
3
AA seq 1270 aa
MDSFDIALLQEWDLESLWGEDVLSQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERR
NQETQQDDSTFNSSYSLFSEPYKTNKGDELSSRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQAPVNKIDEHFVADPRAQTQPASVGSTTSTPAAVPGQQSKRGAMGWQKAGHPPS
DGQQRAAPQGSLRTLLGDGVGRQQPRTKQVCNVEVGLQTQDRPPAMTAKHSSGGHCVQNF
PPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTEASVHCTSYRGGPAAKPESAR
AKGKLSKFGIPKQGEESRSGETNSCVEEIIREMTWLPPLSGIQAPGKVEPSKFPFPNKDS
QLVSSGHNNPKKGDAEPESPDNGTANTSSLGWLSPFTDKGNDALRGMLEDDLKLSSDEEE
NEQQATQRTALHALSDSAGVQQANGRASAPSSKGSSSGSSSSSGSSSSSDSESSSGSDSE
TESSSSESEGSKPPHYSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYY
PPVKDDTQDCGKLPEVCPSSLRDKDIKSACKEEQRPRTANKAPGSKGVKQKSPPAAVAVA
VTAAPAAPPPAVPGAPAESAPPPARRSGGKKPTRRTERTSAGDGANGLRPEEPVAADALG
ASVAVPPEPTKPRPCGNGRTSHRKELRSAVTCEKRRTRGLSRIVPKSKEFIETESSSSSS
SSDSDLESEQEDYPLSKAQAVATAAPGNEQRLKEAANSIIGGGPRAPVGSINARTTSDIA
KELEEQFYTLVPFGRNELLSPLKDSEEVRSLWVKIDLTLLSRIPEHLPQEPGVLSGPASK
EAESAPPSHTADAPPEKALPKSKRKRKCDNEDDYREIKRAQGEKESSSRLTASGSSTLSA
NHCNMTINSLAIPINKNEKMLRSPISPLSDAAKHKYPGEDFTSSSRSNSSGLFPSNSSNK
KHKAESQLQTHAGDLPKAAHGNSESVLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRS
ADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETV
ELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKN
SSKAAQAPSPWGASGKSTGTPSPMSPNPSPTSSVGSQGSLSNANALSPSTIVSIPQRIHQ
MAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGL
HWLRNSAHLA
NT seq 3813 nt   +upstreamnt  +downstreamnt
atggacagcttcgacatagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacgtcttaagccagaggaatgactctctagttgtggagtttcagtcgtcagccagcaga
tgcaggagtgtctacgaaccagatagaaatgtgttacggaggaaagaacgagagagaaga
aatcaggaaacacaacaggatgacagcacgtttaattcgagctactccctcttcagcgaa
ccctacaagactaacaagggggatgagctctccagccgcatccagaacactttaggcaat
tacgatgaaatgaaggactttttaacagatagatctaaccagagtcatctggttggtgtc
cccaaacctggggttcctcaggctcctgtgaacaagattgatgagcatttcgtggcagat
ccgagagcccagacccagcctgcatctgttggcagcaccacctccacaccagcagctgtc
cctgggcagcagagtaagcggggcgccatgggctggcagaaggctggccacccgccgtcc
gatggtcagcagagagcagcaccacagggctctctcaggaccttgctcggagatggggtt
ggcagacagcagccacggaccaaacaagtctgcaatgtcgaagtaggtcttcagacccag
gacaggccgcctgccatgacagccaagcacagcagtggtggccactgtgtccagaacttt
cctccatccctggcttcgaagcccagcctggtccagcagaagccaactgcctacgtgcgg
ccaatggatggccaagaccaggctcctgacgagtctccaaagctcaagtcgtccacagaa
gccagcgtgcactgcacatcgtacaggggcggccccgctgccaagccagagtccgccaga
gccaagggcaaactttccaagtttggcatccccaagcaaggagaggagagtagatctgga
gaaaccaacagctgtgttgaagaaatcattcgggaaatgacctggcttccaccactttct
ggtattcaagcacctggcaaagtggaaccaagcaaatttccatttccaaataaggactct
caactcgtttcctctggacacaataatccaaagaaaggtgatgctgaaccagagagtcca
gacaatggcacggccaatacatcctctctgggatggttatccccatttacagataaggga
aatgatgcactgagaggaatgctagaagatgaccttaagctaagtagcgatgaagaggag
aatgaacagcaggcaacccagagaacagctctccacgctctgtctgacagcgccggggtc
cagcaggccaacggcagggcctctgcaccctccagcaagggcagcagcagcggcagcagc
agcagcagcgggagcagttcctccagtgactctgagagcagctcgggatctgactcggag
actgagagcagttccagcgagagtgagggcagcaagcccccccactactccagccccgag
gccgagccagcgtcctctaacaagtggcaattggataaatggctgaacaaagttaatccc
cacaagcctcctattctgatccaaaatgaaagtcacgggccagagagcaatcagtactac
cctcccgtgaaggatgatacacaggactgtgggaagcttccagaagtctgccccagcagc
ctgagagacaaggacatcaagagcgcctgcaaggaggagcagagaccaaggaccgcgaac
aaggcccccgggagcaaaggggtgaagcaaaagtcccctcccgctgccgtggccgtggct
gtgaccgccgcccccgccgccccgccacccgctgtgcccggggcgcctgccgagagcgcg
cctccaccagcccggaggtcagggggcaagaagcccacccggcgcactgagaggacctcg
gccggcgacggtgccaacggcctccggcctgaggagcccgtggccgccgatgcgctgggg
gcgagcgtggcggttcccccggagcccaccaagcccaggccctgcggcaacggcaggacc
agccaccgcaaggagctgcgctcggccgtgacctgcgagaagcgccgcacgcgggggctg
agtcggatcgtccctaaatccaaagagttcatcgagacagagtcttcctcttcgtcctcc
tcctcagactcggacctggagtcagagcaggaggattatcccctgtccaaggcgcaggcg
gtggccaccgccgcccctgggaacgagcagaggctgaaggaggctgccaacagcatcatc
ggcggcggcccccgggcccccgtgggctccatcaatgccaggaccaccagtgacatcgcc
aaggagctagaagagcagttctacaccctggtccccttcggccgcaatgaactcctctcc
ccattgaaggacagtgaggaggtcaggtcgctctgggtcaaaattgacttgaccctcttg
tccaggatcccagaacacctgcctcaggagccgggggtcttgagtggtcctgcatccaag
gaagctgagagtgcacccccaagccacacagctgacgcgcccccagaaaaggctttgcca
aaatccaagaggaaacgtaagtgtgacaacgaagacgactacagggagatcaagagagcc
cagggagagaaggagagctcctcacgactgaccgcctctggcagcagtaccctgtctgcc
aaccactgcaacatgaccatcaacagcttggcaataccaataaataaaaatgaaaaaatg
ctccggtcacccatctcacccctctccgatgctgcgaaacacaaatacccaggcgaggac
ttcacttcctccagcagatccaacagcagtggtttgttcccttccaactcctccaacaaa
aagcataaggccgagagccagctgcagacccacgccggagacctcccgaaagcagctcac
ggcaactccgaaagcgttctccataagtcacgcccgcagacagagccgtggtctccgggc
tccaatggccacagggactgcaaaaggcagaagctcatcttcgatgatatgccacgcagt
gcagattattttatgcaagaagctaagcgaatgaagcataaagcagacgcaatggtggaa
aagtttggaaaggctctgaactatgctgaagcagccttgtcatttattgagtgtggaaat
gccatggaacaaggccccatggaatctaaatctccttacacgatgtattcggaaacagta
gagcttatcaggtatgctatgagactaaaaacccactcaggacccaatgccacgccagag
gataaacagctggctgcattatgttaccgatgcctggctctcctgtactggcggatgttt
cgactcaaaagagatcatgctgtaaagtattcaaaagcacttatcgactatttcaagaat
tcatctaaagctgcccaagccccatctccatggggggccagtggaaagagcactggaacc
ccatcccccatgtctcccaacccctcccccaccagctccgtgggatctcaggggagcctc
tccaatgccaacgccttgtcgccttcaaccatcgtcagcatcccgcagcgcatccaccag
atggcagccaatcacgtcagcatcaccaacagcatccttcacagctatgactactgggag
atggcggacaacctggccaaggaaaacagagaattcttcaacgacctggacctgctcatg
gggccagtcaccttacacagtagcatggagcacctggtccagtactcccagcagggcctg
cactggctgcggaacagcgcccacctggcatag

DBGET integrated database retrieval system