KEGG   Sus scrofa (pig): 100522839
Entry
100522839         CDS       T01009                                 

Gene name
ID1
Definition
(RefSeq) DNA-binding protein inhibitor ID-1
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100522839 (ID1)
   04350 TGF-beta signaling pathway
    100522839 (ID1)
   04390 Hippo signaling pathway
    100522839 (ID1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100522839 (ID1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100522839 (ID1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    100522839 (ID1)
SSDB
Motif
Pfam: HLH Dsl1_N
Other DBs
NCBI-GeneID: 100522839
NCBI-ProteinID: NP_001231629
Ensembl: ENSSSCG00000007227
UniProt: A0A4X1SRC9 B3W6M6
Position
17
AA seq 154 aa
MKVASGSATATAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGPGARLPPLLDEQQ
VNVLLYDMNGCYSRLKELVPTLPQNRKVSRVEILQHVIDYIWDLELELNSESQVGTQGGR
GLPARAPLSTLNGEISALAAETACVPADDRILCR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaaggtcgccagtggcagcgccacggccaccgcgggccccagctgcgcgctgaaggcc
ggcaagacggcgggcggcgcgggcgaggtggtgcgctgcctctccgagcagagcgtggcc
atctcgcgctgtgcgggtggccccggggcacgcctgcctcccctactcgacgaacagcag
gtgaacgtgctcctctacgacatgaacggctgctattctcgcctcaaggagctggtgccc
actctgccccagaaccgcaaggtgagcagggtggagatcctccagcatgtcatcgactac
atctgggacctggagttggagctgaactcggaatcccaagttgggacccaaggcggccgg
ggactccccgcccgggctccgctcagcaccctcaacggcgaaatcagcgccctggcggca
gagacagcatgtgttccagcggacgatcgcatcttgtgtcgctga

DBGET integrated database retrieval system