KEGG   Sus scrofa (pig): 100523209Help
Entry
100523209         CDS       T01009                                 

Gene name
COL7A1
Definition
(RefSeq) collagen alpha-1(VII) chain
  KO
K16628  collagen, type VII, alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100523209 (COL7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen fn3 VWA VWA_2 Kunitz_BPTI Pur_ac_phosph_N DUF4992
Motif
Other DBs
NCBI-GeneID: 100523209
NCBI-ProteinID: XP_005669576
Ensembl: ENSSSCG00000011355
UniProt: F1SKM1
Position
13
AA seq 2938 aa AA seqDB search
MRLRLLVAVLCAGILAGAPRVRAQHRERVTCTRLYSADIVFLLDGSSSIGRSNFREVRGF
LEGLVLPFSRAASAQGVRFAAVQYSDDPRTEFSLDTLGSGGDVIRAIRELSYKGGNTRTG
AAILHVADQVFLPQLARPGVPKVCILITDGKSQDLVDAAAQRLKEQGVKLFAVGIKNADP
EELKRIASQPTSDFFFFVNDFSILRTLLPLVSRRVCTTAGGVPVTLPPDDSTSGPRDLVL
SEPGSQSLRVQWTAASGPVTGYKVQYTPLTGLGQPLSSERREVSVPAGETSVRLQGLRPL
TEYQVTVVALYANSIGEAVSGTARTTALEGPELTIQNSTAHSFLVAWQSVPGATGYRVTW
RVLSGGAMQQQELGPGQGSVLLHDLEPGTDYEVTVSALFGRNLGPATSLTARTDISVEQT
LRPLILGPTSILLSWNLVPEARGYRLEWRRESGLEVPQKVVLPSDVTHYQLDGLQPGTEY
RLTLYTLLEGREVATPATVVPTGPELPVGPVMDLQATELPGQRVRVSWSPVPSATEYRIT
MRSTQGVERTLVLPGSQTAFDLDDVRAGLSYTVRVSARVGAREGSASVLTVRREPEAPLA
VPGLRVVASDTTRVRVAWGPVPGASGFRISWRTDNGLESVQTLPPEATATDITGLRPGTS
YQVAVSALRGREEGLPAVIVARTDPVDPVRTVRVTQATSSSVTITWNRVPGATGYRVSWH
SGHGPEKSQLVSGETTVAELDGLEPDTEYTVRVWAHVAGADGPPASVVVRTDPQPVGSVS
KLQILNASSDVLRVTWVGVTGATAYRLAWGRSEGGPTRQQMLPGNTDSAEIRGLEGGVSY
SVRVTALVGDREGAPVSIVVTTPPEAPPALETLRVVQRGEHSLRLRWQPVPGVRGFRLRW
RPEGGQEQSRVLGPELSSYELDGLEPATQYRIWLSVLGPAGEGPPSEVTAYTESSRFPST
ELRVVDTSLDSVTLAWTPVSGVSSYILSWRPLRGPGQELPGASQTLSGTSNSQRVTALEP
GVSYIFSLTPVREGVQGPVASVTQNPVCPRGLMDVVFLLHTTRDNAHRSEAVKRALERLV
SSVGPLGPQGVQVGLLSYSHRPSPLLSLNSSYDPGIILQNIRNIPYMDPSGNNLGVAVVT
AHRYLLALDAPGRRRQVPGVMVLLVDEPLRGDFFSPIREAQAAGLKVMILGLAGADPEQL
RRLVPGMDPVQNFFAIDDGPSLDRAVSGLATALCQTALTSQPQPEPCLVHCPKGQKGEPG
EMGLRGQAGPPGPPGLPGRIGAPGPPGPPGSAIAKGERGFPGADGSPGSPGRPGTPGTSG
PKGSPGWPGPRGEPGERGPRGPKGEPGEPGRVIGGEGPGLPGQKGDPGLPGPPGSRGPSG
DPGPRGPPGFPGTAVKGEKGDRGERGPPGPGDGTAAPGDPGLPGLPGSPGPQGPVGPPGE
KGEKGDSEDGAPGLPGQPGVPGERGLRGFPGDTGPKGDRGLTGAVGEPGEKGERGSPGPV
GPQGPPGVPGRPGAEGPEGPPGPTGRRGEKGEPGRPGDPAVGPGGAGAKGEKGDMGPTGP
KGATGTKGERGPPGLALPGDPGPKGDPGERGPIGLTGRAGPPGDSGPPGEKGDPGRPGTP
GLVGPRGRDGEVGEKGDEGPPGDPGLPGKAGERGLRGAPGARGPVGEKGDQGDPGEDGRN
GSPGPSGSKGDRGEPGPPGPPGRLVDTGLGAGEKGEPGDRGQEGPRGPKGDPGPPGASGE
RGISGLRGPPGPQGDPGVRGPAGEKGDRGPPGLDGRSGLDGKPGAAGPPGLQGTAGKAGD
PGRDGLPGLRGEQGPPGPPGPPGALGKPGEDGRPGLNGKNGEPGDPGEDGRKGEKGDSGA
PGREGHDGPKGERGAPGSPGLQGPPGLPGQVGPPGQGFPGMPGSSGPKGDRGEIGPKGEQ
GLPGERGLRGEPGSVQNVERLLENIGLKTSALREIVETWDESSGSFLPVPERLRGPKGNP
GERGPPGKEGPIGFSGDRGPKGDRGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGIPGL
PGRAGSVGEAGRPGERGVRGEKGERGEQGRDGSPGLPGPPGPPGPKVAVDEIGSGLSRDQ
GPPGLKGAKGEPGSDGDRGPKGDRGMPGIKGDRGEPGQRGHDGSPGLPGERGVAGLEGKP
GPQGPRGVPGPVGGHGDPGPPGAPGLAGPSGPQGPSGLKGEPGDTGPPGRGLPGPTGAVG
LPGPPGPSGLVGPQGAPGLPGQVGETGKPGAPGRDGASGKDGERGVPGVPGSPGLPGPVG
PKGEPGPMGTPGQAVIGPPGAKGEKGTPGGLAGDLVGEPGAKGDRGLPGPRGEKGEAGRA
GEPGDPGEDGQKGAPGLKGNKGDPGVGAQGPPGPLGPPGLKGDLGPPGPPGAPGIVGFPG
QTGLRGEMGQPGPSGERGLAGLPGREGAPGPLGPPGPAGSVGAPGAPGLKGDKGDPGAGP
PGARGERGEPGVRGEDGRPGPEGPRGLMGPPGGRGERGEKGDAGSSGLKGDKGDSAVTVG
PPGPRGAKGDMGERGPRGLDGDKGPRGDSGDPGEKGTKGEPGDRGSAGLLGPRGLTGPKG
EPGAAGIPGDPGSPGKDGVPGVRGDKGDVGFMGPRGLKGERGVKGACGLDGEKGDKGEAG
PPGRPGLAGRKGELGEPGIPGPSGAPGKEGLIGPKGDRGFDGQPGPKGDQGEKGERGPPG
TGGFPGPRGSDGSSGPPGPPGSVGPKGPEGLQGQKGERGPPGESVVGAPGAPGTPGERGE
QGRPGPAGPRGEKGEAALTEDDIRGLVRQEMSQHCACQGQFIASGSRPLPSYAADTAGPQ
LHRVPVLRVSHAEEEGQVPPEDDEYEYSEYSVEEYQNPEAPWDGDAPDPCSLPLDEGSCT
AYTLRWYHRAVAGGTVACHPFVYGGCGGNANRFETREACESRCPPRMAQSQGTGAARS
NT seq 8817 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcggctcctggtggccgttctctgcgccgggatcctggcaggggctccccga
gtgcgggcccagcacagggagagagtgacctgcacacgcctttactctgctgacatcgtg
ttcctactcgatggctcctcgtccattggccgcagcaacttccgagaagttcgaggtttc
cttgaggggctggtgctgcccttctcccgggcagccagtgcacagggtgtgcgctttgct
gccgtgcagtacagcgacgacccacggacagagttcagcctggacacacttggctcaggg
ggtgatgtgatccgtgccatccgtgagctcagctacaaggggggcaacacgcgcacaggg
gctgcgattctccatgtggctgaccaagttttcctgccacagctggcccgacctggtgtc
cccaaggtctgcatcctcatcacggatgggaagtcccaggacctggtggacgcagctgcc
cagaggctgaaggagcagggagtcaagctgtttgctgtggggatcaagaacgccgacccc
gaggagctgaagcgaatcgcctcacagccgaccagcgatttcttcttctttgtcaatgac
ttcagcatcttgaggacactcctgcctctcgtttcccggagggtgtgcacaactgcgggt
ggtgtgcctgtgaccctgccccccgatgactcgacctctggtccacgagacctggtgctg
tctgagccaggcagtcaatccttgagagtacagtggacagcggccagtggccctgtgacc
ggctacaaggtccagtacacacctctgacggggctgggacagccactgtcaagcgagcgg
cgggaggtaagcgtcccagctggagagaccagcgtgcggctgcagggtctccggccactg
actgagtaccaagtgacagtggttgccctctatgccaacagcatcggggaggccgtgagc
gggacggctcgaaccactgccctggaggggccggagctgaccatccagaacagcacagcc
cacagcttcctggtagcctggcagagtgtgccaggtgccactggctaccgtgtgacatgg
cgggtcctcagtgggggagccatgcagcagcaggagctgggccctgggcaggggtcagtg
ttgctgcatgacctggagcctggtacagactatgaggtgaccgtgagtgccctatttggc
cggaatttggggcctgccacctccctgactgctcgtactgacatttctgtggagcagacc
ctgcgacctctcatcctgggccccacatccatcctcctttcctggaacttggtgcctgag
gctcgcggctaccggctggagtggcggcgtgagagtggcttggaggtaccacagaaggtg
gtgctgccttctgatgtgacccactaccagttggatgggctgcagccaggcacagagtat
cgcctcacactctacacgctgctggagggccgcgaggtggccacgcctgcaaccgtggtc
cctactgggccagagctgcctgtgggccctgtgatggacctacaggcgactgagctgccc
gggcagcgggtgcgagtgtcttggagcccagtacccagtgccaccgagtaccgtatcacc
atgcggagcacccagggggtggagcggaccctggtgcttcccgggagtcagacagccttt
gacttggatgacgtccgggctgggctgagctacacagttcgggtgtcagctcgagtgggt
gcccgagagggtagtgccagtgtcctcactgtccgccgggagccagaagccccacttgcc
gtcccggggctgcgggtagtggcatcagacacaacgcgagtgcgggtggcctggggtcct
gttcctggagccagtggatttcggattagctggaggacagacaatggtctggagtccgtt
cagacgttgcccccagaagctactgccacagacatcacggggctgaggcctgggacctcc
taccaggtggcagtgtctgcgttgcgagggagagaggagggcctccctgcggtcatcgtg
gctcgaactgacccagtggacccagtgaggacagtccgtgtgactcaagccaccagctca
tctgtcaccatcacctggaacagggttcctggtgccacaggatacagggtctcctggcat
tcaggccatggcccagagaaatcccagctggtttctggggagaccacagtggctgagctg
gatggtctggagccagatactgagtacacagtgcgtgtgtgggcccacgtggctggcgca
gatgggccccctgcctctgtggttgtgaggactgaccctcagcctgtgggcagtgtgtcc
aagctgcagatcctcaatgcttccagtgatgttctacgagtcacctgggtgggggtcact
ggagccacagcctacagactggcctggggccggagtgagggtggccccacaagacagcag
atgctcccaggaaacacggactcagcagaaatacggggccttgaaggcggagtcagctac
tcagtgcgagtgactgcactcgtgggagatcgtgagggcgcacctgtctccattgtcgtc
accaccccgcctgaggctccgccagccctagagacacttcgtgtagtacagcgaggggag
cactctctgaggctgcgctggcagcctgtgcctggggtacgcggcttccgtctgcgctgg
cgacctgagggtggccaggaacagtcccgggtcctgggcccagagctcagcagctacgaa
ctggacgggctggagccagcgacccaataccgcatatggctgagcgtcctggggccagct
ggagaagggcccccctcggaagtgactgcgtacactgagtcatctcgtttcccaagcact
gaactgcgtgtagtagatacctcacttgactctgtgactctggcctggaccccagtgtct
ggtgtatccagctacatcctatcctggaggccactcagaggccctggccaagaattgcct
ggggcctcacagacactttcagggacctcaaactcccagcgggtaacagcgctagagcct
ggcgtctcctacatcttctccctgacacctgttcgggagggtgtacagggtcctgtggcc
tcagtcacacagaacccagtgtgtccccgtggcttgatggacgtggtgttcctgctgcat
accactcgagacaatgctcatcgttcagaggctgtgaaacgagccctggagcgcctggtg
tcttcagttgggcctcttgggccacaaggagtccaggttggcctcctgtcctacagtcac
cggccctccccactgttgtcgctgaacagctcctatgatcctggcatcatcctgcagaat
atccgcaacatcccctacatggacccgagtgggaacaacctgggtgtagcagtggttaca
gctcacagatacctcttggcactggatgctcctggacgccgccggcaggtgccgggggtg
atggttctgcttgtggatgagcccttgagaggtgacttcttcagccctatccgtgaggcc
caggcagctgggctcaaagtgatgatactgggcctggcgggagctgacccagagcagctg
cgtcgcttggtgccaggcatggaccctgtccagaacttctttgctatagatgatggtccc
agcttggaccgggcagtcagtggcctggcaacagccctgtgtcagacagctttgaccagc
cagccacagccagagccgtgcctggtgcactgtccaaagggccagaagggggaacctgga
gagatgggcctgagaggacaagctgggcctcctggcccccctggcctcccgggcaggatc
ggtgctcctggccccccggggcctcctggaagtgccattgcaaagggtgagaggggcttc
cctggggcagatggatcaccaggcagccctggccgccctgggactcctggaacgtctggc
ccaaagggctccccagggtggcctggccctcgtggagaaccaggggagcgaggacctcga
ggcccaaagggagagccgggagaacctggacgagtcattggaggcgaaggcccagggctt
cctgggcagaaaggcgacccaggacttccaggtccccctggatctcgtggcccatcgggg
gacccaggaccccgtggtcccccaggatttcctggaacagctgtgaagggtgagaaaggc
gatcgtggggaacggggcccccctggaccaggtgatggcactgctgctccaggagaccct
gggctgccgggtcttcctggaagccctggaccccaaggcccagttggcccccctggagaa
aaaggagaaaagggggactctgaggatggagccccaggccttccgggacaacctggggtc
ccgggtgagcggggcctacggggatttcctggagacactggccccaaaggtgaccgagga
ctaacaggggctgtgggtgagcctggagaaaagggtgaacgtggatcccctggaccagtg
ggaccgcaggggccgccgggagttcctggacgtcctggagctgagggtcctgaagggcca
ccaggacccactggccgccgaggggagaagggggagcctggtcgtcctggggaccccgca
gtgggacctggaggtgctggagccaaaggagagaagggagacatggggcccactgggcct
aaaggagctacaggaaccaaaggggagcggggcccacctggcttggctcttcctggagac
cctggccccaagggagaccctggagagcggggtcccattggcctcactggcagagcagga
cctccgggtgactcagggcctcctggagagaagggagaccctgggcggcctggtacccca
ggactcgttggcccccgaggacgagatggtgaagttggagagaaaggtgacgagggcccc
ccgggtgacccaggattgcctggaaaagctggcgagcgtggtcttcggggggcacctgga
gctcgggggcctgtgggtgagaagggagaccaaggagatcctggagaggatggacgaaat
ggaagccccggaccatctggatccaagggtgaccgtggggagccaggccccccaggaccc
cctggacggctggtggacacaggacttggagctggagagaagggggagcctggggatcgt
ggacaggagggtcctcgaggacccaagggtgaccctggtccccctggagcttctggggag
aggggcatcagtggacttcgggggcccccaggtccacagggggacccaggtgtccgaggc
ccagcaggagaaaagggtgaccggggaccccccggcctggatggccgcagtgggttggat
gggaaaccaggagccgccggcccccctgggctgcagggaactgcaggcaaggccggggac
cctgggagagatggacttccaggccttcgaggagaacagggcccccctggcccccctggt
cctcctggagcactgggaaagccaggcgaggacggcaggcctggcctgaatgggaaaaac
ggagaacctggagaccctggagaagacgggaggaagggagagaagggagattcaggcgcc
cctgggagagaaggtcatgatggccccaagggtgagcgtggagctcctggaagccctgga
ctccagggccccccaggccttccagggcaggtcggcccccctggccagggttttcctggc
atgccaggaagttctggccccaagggtgaccgtggggagattggacccaaaggggaacag
ggcctcccaggagagcgtggcctgagaggagagcctgggagcgtgcagaatgtggagcgg
ttgctggaaaacattggcctcaagacgtctgccctgcgggagatcgtggagacctgggat
gaaagctctggcagcttcctgcctgtgcctgaacggcttcgtggccccaagggcaaccca
ggcgagcggggccccccaggcaaggagggacccattggcttttcaggagatcgtgggcca
aagggagatcgtggagaccccggccctcaggggccacctggcctggcccttggggagaga
ggcccccctggacctcccggccttgctggggagcctgggaagcctggtatccctgggctt
ccaggccgggctgggagtgtgggggaggctggaagaccaggagagaggggagtgcgtgga
gagaaaggagaacgtggagaacagggcagagatggctctcctggcctccctggaccccct
gggccccctggccccaaggtggctgtggatgagataggttctgggctctctagagaccaa
ggacctcctggactcaagggcgctaagggggagccaggcagtgacggcgaccgaggcccc
aaaggagacaggggcatgccaggcattaagggcgaccgaggagagcctggacaaaggggt
cacgatggcagcccgggtctaccaggagagcgtggtgtggctgggcttgaagggaagccg
ggtccacaaggtccgaggggggtccctggcccagtgggtggccatggagaccctggaccg
cctggtgccccgggtcttgctggcccctcgggaccccagggaccttctggcctgaagggg
gagcctggagatacaggaccaccaggacggggcctgcctggacctactggagctgtggga
cttcctggcccccctggcccttcaggccttgtgggtcctcagggggcaccaggtttgcct
ggacaagtgggggagacagggaagccgggagcaccaggtcgtgatggtgccagcggaaaa
gatggagagagaggagtgcctggggtgccggggtctccaggtctgcctggccctgttgga
cctaaaggagagcctggacccatggggacccctggacaggctgtgatcgggccccctgga
gcaaagggagagaagggtacccctggaggccttgctggagacctggtgggagagccggga
gccaaaggtgaccgaggactaccagggccccggggtgagaagggcgaagctggccgtgcg
ggggagcctggagaccctggagaagatggtcagaaaggcgctccaggactcaagggtaac
aagggtgacccaggagttggggctcaggggccccctgggccacttggtcctccaggtctg
aagggagacttgggcccccctggcccccctggtgctcctggtattgtcggattccctggt
cagacaggccttcgaggagagatgggtcagccaggccccagtggagagcggggtctggca
gggctcccagggagagaaggagccccaggtcccttggggccacctggaccagctgggtca
gtgggagcacctggggcccctggactcaaaggagacaagggagacccgggagcagggcca
cctggggcccgaggagagcgtggggagccaggtgtccggggtgaagatggccgccccggc
ccagagggaccccgaggactcatgggccccccaggcggccggggggaacgtggggagaag
ggtgatgctggaagctcagggctaaaaggtgacaagggtgactcagctgtgactgtgggg
cctccagggccacggggtgccaagggggacatgggcgaacgagggcctcggggcttggac
ggtgacaaaggacctcggggggacagtggggatcctggagagaagggcaccaagggagag
cctggtgacaggggctcagctgggttgctgggaccacgaggacttacgggacccaagggc
gagcctggtgctgcagggatccctggtgacccgggatccccaggaaaggatggagtccct
ggtgtccgaggagacaaaggagatgttggcttcatgggtccccggggcctcaagggcgaa
cggggggttaagggagcctgtggcctcgatggagagaagggagataagggagaagctggt
cccccgggccgcccagggctagcaggacgcaaaggagagttgggggagccaggtattcca
ggcccgtcaggagcccctggaaaggagggcctgatcggccccaagggtgaccgaggcttt
gatgggcagccaggacccaagggtgaccagggtgagaaaggggaacgggggcccccagga
actgggggcttcccaggtcccaggggcagtgatggctctagcgggccccctgggccacct
ggcagtgttggtcccaaaggccctgaaggacttcagggccagaagggtgagcgaggtccc
cctggagagagtgtggtgggggcccctggggcacctggaacccctggagaaagaggggag
caggggcggccaggccctgcagggccccgtggtgagaaaggagaagctgcgctgactgag
gatgacatccggggacttgtgcgtcaggagatgagtcagcattgcgcctgccagggtcag
tttattgcatctggatcacgaccccttccgagttacgctgcagacactgctggcccccag
ctccaccgcgtgcccgtgctgcgtgtctctcatgcagaggaggaaggccaggtgcccccc
gaggacgacgagtatgaatactcagagtactccgtggaggaataccagaaccctgaggct
ccctgggatggcgatgccccagatccctgctcacttccactggatgagggctcctgtact
gcctacaccctgcgctggtatcatcgggctgtggcaggtggcacggtggcctgtcatccc
tttgtctatggtggctgtggagggaatgccaaccgttttgagacccgtgaggcctgtgag
agccgctgcccaccccggatggcccagagccaggggacaggtgctgcccggagttga

DBGET integrated database retrieval system