KEGG   Sus scrofa (pig): 100523300Help
Entry
100523300         CDS       T01009                                 

Gene name
SSR4
Definition
(RefSeq) translocon-associated protein subunit delta isoform X1
  KO
K04571  translocon-associated protein subunit delta
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100523300 (SSR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAP-delta
Motif
Other DBs
NCBI-GeneID: 100523300
NCBI-ProteinID: XP_003135530
Ensembl: ENSSSCG00000012784
Vega: OTTSUSG00000004939
UniProt: K7GK90
Position
X
AA seq 173 aa AA seqDB search
MAALASLGALALLLLSGLSCCSAEACVEPQITPSYYTTSDAVISTETVFIVELSVTCKNR
VQNMALYADVSGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQR
NNEDVSVIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggcatctctcggcgccctggcgctactcctgctgtccggcctctcctgc
tgctcagcagaggcctgtgtggagccccagatcacgccctcgtactataccacgtcggac
gccgtcatctccacagagaccgtgttcatcgtggaactctccgtgacgtgcaagaacagg
gtccagaacatggctctttatgctgacgtcagtggtaaacagtttcctgtcacccggggc
caagacgtggggcgttatcaggtgtcctggagcctggaccacaagagcgcacatgcgggc
acctacgaggtcaggttcttcgatgaggagtcctacagcctcctgaggaaggctcagaga
aataacgaggacgtttccgtcatcccgcctctgttcacagtcagcgtggaccatcggggc
acttggaacgggccctgggtctccacagaggtcctggccgcagccattggcctggtgatc
tactacctggccttcagtgccaagagccacatccaggcctga

DBGET integrated database retrieval system