KEGG   Sus scrofa (pig): 100523844Help
Entry
100523844         CDS       T01009                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100523844 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100523844 (PIK3C2G)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     100523844 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX PI3K_C2 C2 PI3K_rbd DUF4135 DUF1155
Motif
Other DBs
NCBI-GeneID: 100523844
NCBI-ProteinID: XP_013843805
Ensembl: ENSSSCG00000000591
Position
5
AA seq 1511 aa AA seqDB search
MAYCWKTDRDSSESHEKQQEHHESHSVNQPLFPSQVSLGFDHIVDEISNKVPLYQREIEK
NTIFVPSASSWDSRRHSLDETHQISLNEFISRSSELSCHQGSKTPVIGFSHSVLPDSQRK
KKESSWGNPTENYHGADDSRFDILAPPSSGLDKTNSRSELENENHNYHIGFESSIPLIYP
TSSNDSMPKEENKRRRNMNIVEPSLMIFKGSLLPRTWESTCPKNIEPTGCTIQLVEVPQG
SNMSLASFCDKVKKIRETYHADDINSNSGKIWSTTTAFPYRLFPNTKFNISIFTDNSTQQ
LHFMPYANYLVKDLIAEILHLCTNDQLSSKDHLLSICGYEEFLQNDQYLGSHRIFQKNKS
VLQLTLQKNREAPGKLSRKHADDHSQFYLNQLLQFMHIWKVSRQCLSTVIKKYDFHLRYL
LKTQQNMDNMIEEVKNICGVLGCVETKQITDAINELNLILQRKAESFHQNSETSTKGLIE
KVTTKLSMSIYQLIDIYCCSFYADFQPLNAPNSVSCVNLGLHSHLSFTVYAAHNIPETWV
HSYKAFSFSCWLTYAGKKLCQVRNYRNIPVKKLLFFLVNWNETINFPLEIKALPRESMLT
IKLFGVTCATNSADLLAWTCFPLFPKQRYILRSVLFSTTLQDEPPLEMIAPGVWDISQPS
PVTLQINFPATEWEYMKLDSQENRSDLEEPPKECLKHISRLSQKQSPLLLSEEKRRYLWF
YRFYCNNENCSLPLVLGSAPGWDEKTVSEMHAILRRWKFSHPLDALGLLTSSFPDQEIRK
VAVQQLDKLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLHRSLQSIQIAHRLYWLLKDA
QNEAYFKSWYQKLLAALQFCVGKALSDEFSKEKKLIKILGDIGEKVKSASDPQRQEVLKK
EIGRLEEFFQGSDTCHLPLNPAVCIKGIDGNACSYFTSNALPLKITFINANPMGRNISVI
FKAGDDLRQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKGQGLVQMVPDAVTLAKI
HRHSGLIGPLKENTIKKWFSQHNHLKVDYEQALRNFFYSCAGWCVVTFILGVCDRHNDNI
MLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEYFITEGGKNPQHFQDFVELC
CRAYNIVRRHSRLLLNLLEMMLHAGLPELSGIQDLKYVYDNLRPQDSDLEATSHFTKKIK
ESLECFPVKLNNLIHTLAQMTAISPAKSTSQTFSQESCMLSATRSIQKATILGFSKKTNH
LYLIQVTHSKNETILTEKSFDQFSKLHSQLQKQFVSWTLPEFPHWWHLPFTNSDHKRFRD
LNHYMEQILNGSYEVANSDCVLSFFLSDPVEQAVEELSPVDLGEKFPDKKPKVQLVISYE
DAKLTILVKHMKNIILSLIDHWSNKSSIESHLKCCMQSEHLPDGSVPSAHVEFYLLPYPS
EVRRRKTKSVPKCTNPTYNEIVVYDEVTELQGHVLMLIVKSKTTFVGAINIRLCSVLLNE
EKWYPLGNNII
NT seq 4536 nt NT seq  +upstreamnt  +downstreamnt
atggcatattgttggaaaacagatcgcgattccagtgaatcacatgaaaaacagcaggag
caccacgaatctcactctgtaaatcaacccctttttcctagccaagtcagtctgggattt
gatcatatagtggatgaaatcagcaataaagtcccactctatcagagagaaattgaaaaa
aacaccatttttgtgcccagcgcatcaagctgggactcaagaaggcactcattagatgaa
acacaccaaatatccttgaatgaattcatttctagaagttcagagctctcctgtcaccaa
gggagtaaaacaccagtaattggctttagccattctgtgctaccagattctcaacgcaag
aaaaaagaaagctcttggggaaaccccacagaaaattaccatggtgctgatgattccaga
ttcgatattttagctccaccatcaagtggtctggataaaactaattcacggagcgaactg
gaaaatgaaaatcataactaccatataggatttgaaagtagtattcctcttatatatcca
acctcctcaaatgactcgatgccaaaagaagaaaataaaaggaggagaaatatgaacatt
gtggaaccttctctgatgatctttaaaggttctcttctacccaggacgtgggaaagtaca
tgtccaaagaacatagagccgacaggttgtaccattcagctggttgaagtacctcaaggc
agtaatatgagtctggcttccttttgcgacaaagtaaaaaaaataagagaaacctatcat
gcagatgacattaactccaattcggggaagatctggagcacgactacagcatttccatat
aggctctttcctaatactaaatttaatataagtatttttactgataactcaacacaacaa
cttcattttatgccatatgctaattatcttgtgaaagacctaatcgcagaaattctacat
ctttgcaccaatgaccagttatcatctaaagatcaccttctaagtatatgtggctatgaa
gaatttttacaaaatgaccagtatttgggaagccacaggatatttcagaaaaataaatct
gttcttcaacttactctacagaaaaacagggaagctccaggaaagttatctcgaaagcat
gcagatgaccacagtcagttttatctgaatcaacttctacaatttatgcatatttggaaa
gtatccagacagtgtctctcaacggtaataaaaaaatatgacttccacctgcgatactta
ttgaaaacccagcaaaatatggataatatgattgaagaagttaaaaatatatgtggtgtt
ctgggatgtgtggagaccaaacaaattacagatgctataaatgaactaaatcttattctt
cagagaaaggcagagagttttcatcaaaattcagaaacttcaacaaaaggtttgattgaa
aaagtgacaaccaaactatccatgtccatctaccagctaattgatatctattgctgcagc
ttttatgcagatttccagcctctgaatgcacctaatagtgtttcctgtgtaaatcttggg
ctccattcccaccttagtttcacagtgtatgctgctcacaacattccagagacctgggtg
cacagctataaagcattttctttttcctgttggcttacatatgctggaaagaagctgtgt
caagtgagaaactacagaaatattccagtcaaaaaattattatttttcttggtcaactgg
aatgaaacgatcaattttcctcttgaaataaaggcacttccaagggaatctatgctcacc
ataaaactgtttggggttacctgtgccaccaacagtgcagatttattggcctggacttgt
tttccactgtttccaaaacaaaggtacattctccggtctgtgctattcagcaccacattg
caggatgagcctcccctagaaatgatagctccaggagtgtgggatataagtcagccatcc
ccagtgaccctgcagattaattttccagctactgagtgggagtatatgaaacttgattct
caagagaacagaagtgatcttgaagaaccaccaaaagagtgtttaaaacatatctccaga
ctttcacaaaaacagtctcctttactactctctgaagaaaagagaagatacttatggttt
tatcgcttctactgcaataatgaaaattgctcccttcctttggtcctgggtagtgcccct
ggatgggatgaaaaaactgtttcagaaatgcatgccattttgagaagatggaaattttct
caccctttggacgctcttggacttttgacttccagttttccagatcaagaaattcgtaaa
gtggcggttcaacaattagacaaactcttgaatgatgaactactggaatatctcccacag
ctagttcaggctgtcaagtttgagtggaaccttgaaagtcctctagtgcagctcctgtta
caccgctcattgcaaagcatccagattgcccatcgtctttactggctgctaaaggatgca
cagaatgaagcttattttaaaagctggtatcagaaactattggctgctctccaattctgt
gtaggaaaagccttgagtgatgagttttccaaggagaagaaacttataaaaattctggga
gacattggggaaaaagtcaaatctgccagtgaccctcaaagacaggaggttctaaagaaa
gagattggaagactagaagaattctttcagggttccgatacctgtcaccttcctctgaac
cctgccgtgtgcatcaaggggattgatggcaatgcatgttcgtatttcacatctaatgct
ttgccattaaagattactttcattaatgctaatccaatgggcaggaacatcagcgtcatt
tttaaggctggagatgatcttcgtcaggatatgcttgttctgcaaattattcaagtgatg
gacaatatttggctgcaggagggcctggatatgcaaatgatcatttatagatgtctatcc
acaggaaaaggccaaggattggtgcagatggtgcctgatgctgtaaccctagcaaaaatc
catcgccattctggactgataggaccactgaaagaaaatacaatcaaaaagtggttcagt
cagcacaaccatttaaaggtggattatgaacaggccttgaggaactttttctattcctgt
gctggctggtgtgtggtaacgttcatcctgggagtctgtgaccgacacaatgacaatatc
atgctgaccaagtcgggccacatgtttcatattgactttggaaaattcttgggtcatgca
caaacatttggagggataaaaagggaccgggccccttttatttttacttcagagatggag
tactttattacagagggtgggaaaaacccacaacatttccaagattttgtggagctctgc
tgtcgagcttataacattgtcagaagacacagccgactgctcttgaacctactagaaatg
atgctacatgcaggattgcctgagctaagtggaatccaagacctgaaatatgtgtatgat
aaccttcgtccacaagattcagatctggaagcgacaagtcattttaccaagaaaataaag
gaaagtctggagtgtttccctgttaaattgaataacttgatccacacgcttgcacaaatg
actgccataagccctgctaaatccacttcacagactttttctcaggaatcctgtatgctg
agtgcaactaggtcaatccaaaaagcgaccattttagggttcagcaagaaaactaatcat
ctgtatctaatccaggtgactcacagtaagaacgaaacaatcctcacagaaaaatcattc
gaccagttttcaaaacttcacagccaacttcaaaagcagtttgtatcatggaccctccca
gagtttcctcattggtggcacttaccttttacaaattcagatcacaaaagattcagagat
ctaaatcattacatggaacagatattaaatggatcgtatgaagtcgcaaacagtgattgt
gtactcagttttttcctctctgatcctgtggaacaggcagtggaagaactgtcacctgtg
gacctaggtgagaagtttcctgacaagaaacctaaggtccagctagtcatatcctatgag
gatgcgaagctgaccatacttgtgaagcacatgaaaaacattatactttcactcattgat
cattggagcaacaaaagtagcattgaaagccatttgaagtgctgtatgcaatctgagcat
ctcccagatggctctgtgcccagtgcacatgttgaattttatcttctaccataccccagt
gaagttcgtaggaggaaaacaaaatctgttccaaaatgtaccaaccccacttacaatgaa
attgtagtatatgatgaagtcacagagctccaaggacatgtcttaatgcttattgtgaag
agcaaaaccacgtttgtaggagcaatcaacatccgactttgtagtgttctgctcaatgaa
gaaaaatggtatccactaggaaacaatataatttga

DBGET integrated database retrieval system