KEGG   Sus scrofa (pig): 100523913
Entry
100523913         CDS       T01009                                 

Definition
(RefSeq) olfactory receptor 8B12-like
  KO
K04257  olfactory receptor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100523913
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100523913
G protein-coupled receptors [BR:ssc04030]
 Others
  Chemoreception
   Olfactory
    100523913
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 100523913
NCBI-ProteinID: XP_003130081
Ensembl: ENSSSCG00000015189
UniProt: A0A4X1VH61 A0A5G2R608
Position
9
AA seq 311 aa
MAADNTSSVTEFVLAGLTDQPELQVPLFFLFLSFYVVTVVGNLGLITLIGLNSHLHIPMY
FFLFNLSFIDFSYSTTLTPKMLMGFVSKKNIISYAGCMTQFFFFCFFVFSESYILTAMAY
DRYVAICKPLVYTVTMSPQVCLLLLLGVYGMGVFGAVAHMGNVMFMTFCANNLVNHFMCD
IIPLLELSCNSSYVNLLVVFIVVATGIGVSIVTILISYGFILSSILCISSAEGRSKAFST
CSSHIILVSLFFGSGAFMYLKPPSILPLDQGKVSSVFYTIVVPMFNPLIYSLRNKDVKVA
LKKTLSRKIFS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggctgcagataatacctcctctgtgacagagtttgtcctcgcaggcttaacggaccag
ccagagctccaggtccccctcttcttcctgttcctaagtttctatgtggtcactgtggtg
gggaacctggggttgataactctgattggactgaattctcaccttcatattcccatgtac
tttttcctcttcaatttgtccttcatagattttagttactccactactctcacccctaaa
atgctgatgggttttgtctcaaagaagaatattatttcctatgcagggtgtatgactcag
ttttttttcttctgtttctttgtcttttctgaatcctatatcctgacggcgatggcatat
gaccgctatgtggccatctgtaaaccactggtgtacacagtcaccatgtctcctcaggtg
tgtttactccttttgttgggcgtctacgggatgggagtgtttggggctgtggcccatatg
ggaaatgtaatgtttatgaccttttgtgccaataaccttgtcaatcactttatgtgtgac
atcattccccttcttgagctttcctgcaacagctcttatgtaaatttgttggtggtcttt
attgttgtggccactggtattggggtgtccattgtgaccattttaatctcttacggtttc
attctttctagcattctctgcattagctccgcagagggccgatccaaagcctttagtacc
tgcagttcccacataattttggtatctcttttctttgggtcaggagcatttatgtacctc
aaaccaccctctatcttaccccttgaccaagggaaagtgtcctccgtattctataccatc
gttgtgcccatgttcaacccattaatctatagcctgcggaataaggatgtcaaagttgct
ctgaagaaaaccttgagccgaaagatcttctcttga

DBGET integrated database retrieval system