KEGG   Sus scrofa (pig): 100523953
Entry
100523953         CDS       T01009                                 

Gene name
ERAP1
Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100523953 (ERAP1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100523953 (ERAP1)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M1
   100523953 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100523953
NCBI-ProteinID: XP_020941055
Ensembl: ENSSSCG00000014171
Vega: OTTSUSG00000002954
Position
2
AA seq 943 aa
MVFLSIKWPFGTMSFLLWSLLCLITVFTPSWCQSSETTPPKASNGVPFPWNKMRLPEHII
PAHYNLIIHANLTTLTFAGTTEIEITASKPTSTIILHSHRLQISKAALRKGAGEGQSEEP
LXVLEHPPLEQIALLAPEPLVVGLLYTIVIEYAGNLSESFHGFYKSTYRTKEGEIRDIAS
TQFEPTSARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVSEIVTLAEGLVEDHFDV
SVKMSTYLVAFIVSDFKSISKMTKSGVKVSIYAVPDKINQANYALDAAVTLLEFYEDYFS
IPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLLDAEKSSVSSKLAITMTVSHELAHQ
WFGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPDLKVEDYFFGKCFDAMEVDALNSSHP
VSTPVENSAQIKEMFDEVSYEKGACILNMLRDYLGVDAFKSGIVKYLQKYSYKNTKNEDL
WNSMASICPTDGTQRMDGFCSSGEHSSSSSHWRQEGLDVKTMMNTWTLQKGFPLVTVTVR
GRNVHVKQEHYVKGLDDAPETGYLWHVPLTFITSKSDSIQRFLLKTKTDVLILPEEVEWI
KFNVGMNGYYIVHYEDDGWDSLTGLLKTTHTAISSNDRASLINNAFQLVSIGKLSIEKAL
DLTLYLKRETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKDFLIRLLRDLIDKQTWTD
EGSVSERLLRSQLLLLACVRKYQPCVQLAEGYFRQWKEADGNLSLPRDVTVAVFAVGAQD
PEGWDFLYSKYQSSLSSTEKNHIEFALSMSQNKEKLQWLLDQSFKGDIIKTQEFPYILRA
VGRNPVGYPLAWQFLRENWNQLVQKFELGSNSIAHMVIGTTNQFSTRARLEEVKEFFSSL
KENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQDEKLTQL
NT seq 2832 nt   +upstreamnt  +downstreamnt
atggtatttttgtccatcaaatggccgtttggaaccatgtcctttctactttggtcattg
ttgtgtctcataactgtgttcactccatcctggtgtcagagcagtgaaactacacctcca
aaagctagtaacggggtaccgtttccttggaataaaatgcggctccctgagcacatcatc
ccagctcactacaatctcattattcacgctaacctcaccactctgacttttgcgggaacc
acagaaatagaaatcacagccagcaagcccaccagtaccatcatcctgcatagtcaccgc
ctgcaaatatctaaggccgccctgaggaagggggctggcgagggacagtctgaagagccg
ctgnaagtcctggaacacccgcctctggagcagatcgcgctcctggctcctgagcctctg
gtggttgggctcctgtacaccattgtcatagaatatgctggcaatctttctgagagtttc
catggattttataaaagcacctacagaaccaaggaaggggaaatcagagatattgcatca
acacagtttgaacctacttcagccagaatggcctttccctgctttgatgaacctgctttc
aaagcaagcttttcaatcaagatcagacgggaaccaaggcaccttgccatctccaatatg
ccattggtgagtgaaatcgtaactcttgctgaaggacttgtagaagaccattttgatgtc
tctgtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctattagc
aagatgaccaagagtggagtcaaggtttccatatatgctgttccagacaagataaatcag
gcaaattatgctctggatgctgcagtgactcttctcgaattttatgaggattatttcagc
atcccatatcccttacccaaacaagatcttgctgctattcctgactttcagtctggtgct
atggaaaactggggactaaccacgtatcgggaatcttctctgttgcttgatgctgaaaaa
tcttctgtgtcaagtaagcttgccatcacgatgactgtgtcccacgaacttgcccaccag
tggttcgggaaccttgtcacgatggaatggtggaatgatctttggctaaatgagggattt
gccaagtttatggagttcgtgtctgttagcgtgactcatccagacctgaaagttgaagat
tatttctttggtaagtgttttgatgcgatggaagtagatgcattaaattcctcacaccct
gtgtccacacctgtggagaattctgctcagattaaggagatgtttgatgaagtttcttat
gaaaagggagcttgtattctgaatatgctaagggattatctcggtgtggatgcatttaaa
agtggtattgtgaagtatctccagaaatatagttacaaaaacaccaaaaacgaggacctg
tggaatagtatggcgagtatttgccctacagatggcacacaaaggatggatggattttgt
tctagtggtgaacattcatcttcatcatcacactggcgacaggaaggacttgatgtgaaa
accatgatgaacacctggaccctgcagaagggttttcctctggtaactgtcacagtgaga
ggaaggaacgtacacgtgaagcaggagcactatgtgaaaggactggatgacgcccctgaa
actgggtacctgtggcatgtcccattgacattcatcaccagcaaatcagactccatccaa
agatttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtggaatggatc
aaatttaatgtggggatgaatggctattacattgtgcattatgaagatgacggatgggat
tctttgactggccttctaaaaacaacacacacggcaatcagcagtaatgatcgggccagt
ctcattaacaatgcatttcagcttgtcagcattggaaagctatcaattgaaaaagccttg
gatttaaccctgtacttgaaacgtgaaactgaaatcatgccagtgttccagggtttgaat
gagctgatacctatgtataagttaatggagaaaagagacatgaatgaagtggaaactcaa
ttcaaggactttctcatcaggctgctgagggacctcattgataagcagacctggacagac
gagggctccgtctcagagcgactgctgcggagtcagctgctcctgctcgcctgtgtgcgc
aagtatcagccgtgtgtgcagctggcagaaggctacttcagacagtggaaggaagctgat
ggaaatttgagcctgcccagagacgtgaccgtggctgtgtttgctgtgggcgcccaggac
cctgaaggatgggattttctttatagtaaatatcaatcgtcattgtccagtaccgagaaa
aaccacattgaatttgctctcagtatgagccaaaataaagaaaagcttcagtggctacta
gatcaaagttttaagggagacataataaaaactcaagagtttccatatatccttagagct
gttggcagaaacccggtgggatatccattggcctggcagtttctgagggaaaattggaac
caacttgtacaaaagtttgaacttggctcaaattccatagcccacatggtaattggaaca
accaatcaattctcgacaagagcacggcttgaagaggtaaaagaattcttcagctctttg
aaggaaaatgggtctcagctccgttgtgtccaacaaaccattgaaaccattgaggaaaac
atacgttggatggataagaattttgataaaatcagagtgtggctacaagatgaaaagctt
acacagctgtaa

DBGET integrated database retrieval system