KEGG   Sus scrofa (pig): 100524215Help
Entry
100524215         CDS       T01009                                 

Gene name
KAT2A
Definition
(RefSeq) histone acetyltransferase KAT2A isoform X4
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04330  Notch signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05166  HTLV-I infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100524215 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100524215 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100524215 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100524215 (KAT2A)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100524215 (KAT2A)
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100524215 (KAT2A)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100524215 (KAT2A)
   HAT complexes
    PCAF complex
     100524215 (KAT2A)
    STAGA complex
     100524215 (KAT2A)
    TFTC complex
     100524215 (KAT2A)
    SAGA complex
     100524215 (KAT2A)
    SLIK complex
     100524215 (KAT2A)
    ADA-HAT complex
     100524215 (KAT2A)
    HAT-A2 complex
     100524215 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 100524215
NCBI-ProteinID: XP_003131453
Ensembl: ENSSSCG00000017414
UniProt: F1S0Q0
Position
12
AA seq 837 aa AA seqDB search
MAEPSQASTPAPAAQPRPLQSPAPAPTPTPALSPASAPTPAPTPAPAPAPAAAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQMVPRPATVSAAVVPSAPIFSPTMGGGGNSSLS
LDSAGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggcctcgaccccggccccagccgctcagccgcgtccccttcag
tccccagcccccgccccaactccgactcctgctctcagccctgcttcggccccgactccg
gctcccactccggcaccagcccccgccccagctgcagccccagccgggagcacagggact
ggggggcccggggtaggaagtgggggtaccgggagcgggggtgatccggctcgccctggc
ctgagccagcagcagcgcgccagccagaggaaagcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgc
aatggctggaaaaaccccaagccccccactgcaccccgcatggacctgcagcagccagct
gccaacctgagcgagctgtgccgtagctgtgagcaccccttggctgaccacgtgtcccac
ctggagaatgtgtcagaggatgagattaaccggctgctggggatggtggtagatgtggag
aatctgttcatgtctgttcataaggaggaggacacggacaccaagcaggtctatttctac
ctcttcaagctcctgcggaagtgcatcctgcagatgacccggcccgtggtggagggatcc
ctgggcagccccccttttgagaagcctaatatcgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacgatgtttgagctctcgaagatg
ttcctgctctgccttaactactggaagcttgagacgcccgcccaattccggcagaggtct
caggccgaggacgtggctacctacaaggtcaattataccagatggctctgttactgccat
gtgccccagagctgcgacagcctcccccggtacgagaccactcacgtctttgggcgaagc
cttctccgctccatcttcaccgtcacccggcgacagctgctggagaagttccgggtggag
aaggacaagctggtgcctgagaagaggaccctcatcctcacccacttccccaaattcctg
tccatgctggaggaggagatctacggggcaaactctccgatctgggagtcgggcttcacc
atgccgccctcggagggaacccagatggtgccccggccggctacagtcagtgccgcggtt
gttcccagcgcccccatcttcagccccaccatgggtgggggtggcaacagctccttgagc
ctggactccgcaggagccgagcccatgccaggcgagaagaggaagctccccgagaacctg
accctggaggatgccaagcggctccgtgtgatgggcgacatccccatggagctggtcaac
gaggtcatgctcactatcacggatcctgctgccatgctggggcccgagacgagcctgctg
tcggccaatgcagcccgggacgagacggcccgcctggaggagcgccgtggcatcatcgag
ttccacgtcatcggcaactcgctcacgcccaaggccaaccggcgggtgttgctgtggctg
gtggggctgcagaatgtcttctcgcaccagctgccgcgcatgcccaaggagtatatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggacgggcgagtcatt
ggtgggatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctcaaatgagcaggtcaagggctatgggactcacctgatgaatcacctgaaggag
tatcacatcaaacacaacatcctctacttcctcacctacgccgacgagtatgccattggc
tacttcaaaaagcagggcttctccaaggacatcaaggtgcccaagagccgctacctgggt
tacatcaaggactatgagggcgcgacgctgatggagtgtgagctgaaccctcggatcccc
tacacggagctgtcccacatcatcaagaagcagaaggagatcatcaagaagctgattgaa
cgcaaacaggcccagatccggaaggtctaccccgggctcagctgcttcaaagagggcgtg
aggcagatccctgtggagagcgtccctggcattcgagagacgggctggaagccgctgggc
aaggagaaagggaaagagctgaaggacccggaccagctctacacgaccctcaaaaacctg
ctggctcagatcaagtcccaccccagtgcctggcccttcatggagcccgtgaagaagtcg
gaggccccagactactacgaggtcatccgcttccccatcgacctgaagaccatgacggag
aggctgcgcagccggtactacgtgacgcggaagctcttcgtggcggacctgcagcgggtc
atcgccaactgccgcgagtacaaccccccagacagcgagtactgccgctgcgccagcgcc
ctggagaagttcttctacttcaagctcaaggagggcgggctcatcgacaagtag

DBGET integrated database retrieval system