KEGG   Sus scrofa (pig): 100524357
Entry
100524357         CDS       T01009                                 

Gene name
RTL4
Definition
(RefSeq) zinc finger CCHC domain-containing protein 16
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: DUF4939 ZapC
Other DBs
NCBI-GeneID: 100524357
NCBI-ProteinID: XP_005673892
UniProt: A0A287B3U8 A0A4X1W4Q4
Position
X
AA seq 309 aa
MENYIDSPPTLQVEHSSLQAENLILQPQMQHVTEENPALRGQVMSALTPPMMPVPCSLEH
LSQFHGDPTNISEFLAQMTTYLTTLKIPNPEDNAHVKFIFDHLSQQMESCGVISGPDQSA
LLKQHENFVLEFQQSFGELTKQEMKSLVTKVDKGDKFSQQDTTTFQLLAQNLRYNETNQS
CHFQEGFADPIHAEVSGTDMMDNLPDLITQCIQVDKKRSNRPELLQSEAQIPVLASLIHH
QTLSSTTGPPPKEDPVQLRGGQPPLTPAKRARQQETHSCLYCSQSGHFTKDCLAKRSRAP
TRTNNSSQQ
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagaattatatagactcaccacctaccttacaggtagagcattcttcccttcaggca
gagaatctgattctgcagccacaaatgcagcatgtgactgaggagaaccctgctctaagg
ggccaagtcatgtctgccctaaccccaccaatgatgcctgtaccctgctcacttgagcat
ctttcccaatttcatggtgaccccaccaatatctcagagtttcttgctcagatgactacc
tacctgacaactttgaagatccccaatcctgaagataatgctcatgtcaagttcattttt
gaccacctatctcagcagatggaaagctgtggggtcatatctgggcctgaccagagtgct
ctgttgaagcaacatgagaactttgttcttgagttccagcagtcatttggtgagctcaca
aaacaggaaatgaagtccctggtgactaaggttgacaaaggggacaaattctcccagcag
gatactacaactttccagctccttgctcagaatctgagatataatgaaaccaatcagagt
tgtcacttccaagagggatttgctgatcccattcacgctgaagtaagtggcacagatatg
atggacaacctcccagaccttatcactcaatgtattcaggtggacaagaaacgtagtaac
aggccagagctcctacagtcagaggcccagatcccagtgttggcttccctgatccaccac
caaaccctctccagcaccacaggtccaccacctaaggaagaccctgtacagctgcgagga
ggccagccacctctcactccagccaaacgagctcgccagcaagaaacacactcttgcctc
tactgcagccagtctggtcatttcacaaaagattgccttgccaaacgttctcgagcccca
acaaggacaaataactcatctcaacagtaa

DBGET integrated database retrieval system