KEGG   Sus scrofa (pig): 100524473Help
Entry
100524473         CDS       T01009                                 

Gene name
PIN4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    100524473 (PIN4)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100524473 (PIN4)
Chaperones and folding catalysts [BR:ssc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    100524473 (PIN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 100524473
NCBI-ProteinID: XP_003135228
Ensembl: ENSSSCG00000023312
UniProt: A0A4X1W136 I3LBW5
Position
X
AA seq 131 aa AA seqDB search
MPPKGKSASGKGGKGKVASGSDSADKKPQGPKGGGNAVKVRHILCEKHGKILEAMEKLKS
GMKFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPISVLDKPVFTDPPVKTKF
GYHIIMVEGRK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaaggaaaaagcgcatcgggaaaaggggggaaaggaaaagtagcctctggg
agtgacagtgctgacaaaaagcctcagggccccaaaggtggtggcaatgcagtaaaggtc
agacacattctgtgtgaaaaacatggaaaaatcttggaagccatggaaaagctaaagtct
ggaatgaaattcaatgaagtggctgcacaatatagtgaagataaagccaggcaagggggc
gacttgggttggatgaccagagggtccatggtgggaccatttcaagaagcagcattcgcc
ttgcctataagtgtgctggataagcctgtgtttacagaccctccagttaagacaaaattt
gggtatcatattataatggttgaagggagaaaataa

DBGET integrated database retrieval system