KEGG   Sus scrofa (pig): 100524478Help
Entry
100524478         CDS       T01009                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha isoform X1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00564  Glycerophospholipid metabolism
ssc01100  Metabolic pathways
ssc05231  Choline metabolism in cancer
Module
ssc_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
ssc_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100524478 (CHKA)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100524478 (CHKA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100524478 (CHKA)
    2.7.1.82  ethanolamine kinase
     100524478 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo
Motif
Other DBs
NCBI-GeneID: 100524478
NCBI-ProteinID: XP_005660667
Ensembl: ENSSSCG00000012889
UniProt: F1RVP9
Position
2
AA seq 453 aa AA seqDB search
MKTKFCNGGEAEPSPLGLLLSCGSGSAAPGPGVGQQRDAASDPEPKQLGGRQPPLALPPP
PPPPLPLPPPPPPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDQFHISVIRGGLSNML
FQCSLPDTLATVGDEPRKVLLRLYGAILKMRSCNKEGSEQAQKENEFQGAEAMVLESVMF
AILAERSLGPKLFGIFPQGRLEQFIPSRRLETEELSLPDISAEIAEKMARFHGMKMPFNK
EPKWLFGTMEKYLNQVLRIKFPGESKAKPLRRFLSYNLPLELERLRSLLESTPSPVVFCH
NDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYNYEKYPFFRA
NMLKYPSRKQQLHFISNYLAAFQHESEDPSDEERSAIEEGMLLEVNRFALASHFFWGLWS
IVQAKISSIEFGYMEYAQARFEAYFDQKRKLGV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaagttctgcaacgggggcgaggcggagccctcgccgctcgggctgctgctg
agctgcggcagcggcagcgcggccccggggcccggcgtggggcagcagcgcgacgccgcc
agtgacccggagcccaagcagctgggcgggcggcagccgccgctcgcgctgcccccgccg
ccgccgccgccgctgccgctgcccccgccgccgccgccgccggcggacgagcagcccgag
ccccggacgcggcgcagggcctatctgtggtgcaaggagttcctgcccggcgcctggcgg
ggcctccgcgaggaccagttccacatcagtgtcatcagaggtggcctcagtaacatgctg
ttccagtgctccctacccgacactctggccaccgttggtgacgagcctcggaaagtgctc
ctgcggctgtacggggcgattttaaagatgaggtcctgtaataaggagggatccgaacaa
gctcagaaagaaaatgaatttcaaggcgccgaggccatggttctggagagcgtcatgttc
gccatcctcgcggagaggtcgctggggccgaagctcttcggcatcttcccccaaggccgc
ctggagcagttcatcccgagccggcggctagaaaccgaggagctgagtctgccggatatt
tctgcagaaatagccgagaaaatggcacggtttcatggcatgaagatgccgttcaataag
gaaccaaagtggctttttggaacaatggaaaagtacctgaaccaagtactgaggattaag
tttcccggggagtccaaagccaagccgctccgcaggttcctcagttacaatctgccattg
gagctggaacgcctgcggtcgttacttgaatccactccatcgccagtcgtgttttgtcac
aacgactgtcaggaaggcaatatcctgctgctggaaggcagggagaactccgagaagcag
aaactcatgctcatcgacttcgagtacagcagctacaactacaggggattcgacattggg
aaccatttctgcgaatggatgtacgactataactacgagaagtaccctttcttcagagcc
aacatgctgaagtacccgtccaggaagcagcagctccattttatttccaattacttggcc
gcattccaacacgagtctgaagaccccagcgacgaggagaggtccgcgatcgaagaaggc
atgttgcttgaggtcaacaggtttgcccttgcgtcccatttcttctggggactttggtcc
atcgtacaggccaagatttcatccattgaatttgggtacatggagtacgcccaagccagg
ttcgaggcctatttcgaccagaagaggaagctgggggtgtga

DBGET integrated database retrieval system