KEGG   Sus scrofa (pig): 100524886Help
Entry
100524886         CDS       T01009                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate receptor 4 isoform X3
  KO
K05200  glutamate receptor 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04713  Circadian entrainment
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04728  Dopaminergic synapse
ssc05031  Amphetamine addiction
ssc05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    100524886 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100524886 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100524886 (GRIA4)
   04728 Dopaminergic synapse
    100524886 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100524886 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100524886 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100524886 (GRIA4)
   05033 Nicotine addiction
    100524886 (GRIA4)
Ion channels [BR:ssc04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100524886 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100524886
NCBI-ProteinID: XP_003129869
Ensembl: ENSSSCG00000030565
Position
9
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVQIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcagaagct
ccttttaatttggtacctcatgtggacaacatagagacagccaacagttttgctgtgaca
aatgctttctgctcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcagtacatactttgacctcattctgcagcgccttacacatctccctcatcacacca
agtttccctaccgagggggagagccagtttgtgctgcaactaaggccttccttacgagga
gcactcttgagtctactagatcactatgagtggaactgttttgtcttcctgtatgacaca
gacagaggatactcgatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagtgctatatgtgtggaaaattttaatgatgtgagctatagacaacttctagaagaa
cttgatagacgacaagagaagaaatttgtaatagactgtgagatagagcggcttcaaaat
atattggaacagattgtgagtgttggaaagcatgttaaaggctaccattatatcattgcc
aacttgggattcaaggatatttctcttgagagatttatacatgggggagccaatgttaca
ggattccagttggtagattttaatacacctatggtaaccaaactaatggatcgctggaag
aaactagatcagagagaatatccaggatctgaaacacctccaaagtacacatctgctctg
acttacgatggcgtccttgtgatggctgaaacgtttcgaaatcttagaagacagaaaatt
gatatttccaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggt
caggggattgacatggagaggacgctcaaacaggttcagattcaagggctcacaggaaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctaaag
agcacaggacctagaaaggttggttactggaatgatatggataaattagtcttgattcaa
gatgtacccactcttggcaatgacacagcagctattgagaacagaacggttgttgtgacc
actattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtccgagaggaagtcattgacttctctaagcccttcatgagtttg
ggcatatctattatgatcaaaaagcctcagaaatctaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtaggtttagtccatatgagtggcacacagaagagccagaagat
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaatagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aaccttgctgctttcctgacggttgagcgaatggtctcccccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacactggattcagggtcaaccaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtgttcactaggactacggctgagggagtagctcgtgtccgaaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgagtacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcttcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcaaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggtgaaaatggccgcgtcttgacacccgactgcccaaag
gctgtacacactggaactgcaattagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system