KEGG   Sus scrofa (pig): 100525099Help
Entry
100525099         CDS       T01009                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00250  Alanine, aspartate and glutamate metabolism
ssc00270  Cysteine and methionine metabolism
ssc00280  Valine, leucine and isoleucine degradation
ssc00350  Tyrosine metabolism
ssc00360  Phenylalanine metabolism
ssc00380  Tryptophan metabolism
ssc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssc01100  Metabolic pathways
Module
ssc_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100525099
   00270 Cysteine and methionine metabolism
    100525099
   00280 Valine, leucine and isoleucine degradation
    100525099
   00350 Tyrosine metabolism
    100525099
   00360 Phenylalanine metabolism
    100525099
   00380 Tryptophan metabolism
    100525099
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100525099
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     100525099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 HI0933_like Pyr_redox Thi4 AlaDh_PNT_C FAD_oxidored FAD_binding_3 GIDA Pyr_redox_3 Glyco_transf_4 Lycopene_cycl Shikimate_DH NAD_binding_7 TrkA_N Trp_halogenase ApbA IlvN NAD_Gly3P_dh_N 3HCDH_N 2-Hacid_dh_C Rossmann-like FMO-like MCRA UDPG_MGDP_dh_N DUF1188
Motif
Other DBs
NCBI-GeneID: 100525099
NCBI-ProteinID: XP_005661217
Ensembl: ENSSSCG00000013976
UniProt: A0A480EIC9 A0A4X1TZY3
Position
2
AA seq 526 aa AA seqDB search
MYLGWLALTLLSVLSLCSQAFNSQLIKCFEDPQYEELVQLAQDGLGKTAERKQIVVIGAG
MAGLTAAKTLQDAGHQVTVLEASARVGGRIETHRVPGAQWYAELGAMRIPANHRLSREFI
RKFGLKLSEFCAFNNQTWVLINRVRQHTGEVQANPHLLGYQVRADEEGKTAEQLFQESLR
KVVEELKSSSCSQVLEKYDSFSTKEYLIKVGNLSLGAVQMIGDLLNADAGYYEAFMETLR
GIISFFQEPRFDEIVGGFDQLPQGLHAALLPGTVHLHSPAEEVESYGDKVHVTYRTSDPL
QPRAHLTADYVIVATTAKAARLLRFQPPLSLGKEDALRSVHYNSATKVILACTQRFWERE
GIFSGKSITDRPSRFIFYPNHIFPNGTGVILASYTLDDDSSFFAAMDHAQVVNIVLDDLA
EVHDLPKEELRAMCPYSKVKHWSQDPYSMGGFASFTPYQYVDYAQELFKSEGRVYFAGEH
TALPHGWIDTAIKSGLRAAQSIQEAVGLALKKGPRDPKEPHSKMEL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtacctaggctggctggccctcactctcctgtctgtgctgagcctgtgtagccaggcc
ttcaacagtcagcttatcaagtgctttgaagacccccagtatgaagagttggtacagctg
gcccaagatgggcttgggaagacggctgaaaggaaacagatagtggtgattggggcaggc
atggctgggctcaccgctgccaagaccctgcaggatgctggccaccaggtgactgtcctg
gaggcctcagcacgtgtgggtggcagaatagagacacacagagtgcctggagcacagtgg
tatgcggagctgggtgccatgaggatacctgccaaccacaggctctctcgtgagttcatc
aggaagtttgggctaaagctcagtgagttctgcgccttcaacaaccagacctgggtgctg
atcaacagggtgcgacagcacacaggggaggtacaggccaatcctcacctgctgggctat
caagtcagggcagatgaggagggaaagacagcagaacaactcttccaagaatcactgcgg
aaggtggtggaagagctgaaaagcagtagctgcagccaggtactagagaagtatgactcc
ttctccaccaaggaatacctgatcaaggtggggaacctgagcctcggggctgtgcaaatg
attggggacttgctgaatgcagatgctggctactacgaggcctttatggagacccttcgt
ggcatcatctccttcttccaggagcccaggttcgatgaaattgttgggggctttgatcag
ctcccccagggcctgcatgctgccctcttgcctggaacagtccacctccactcaccagca
gaggaggtagagtcatatggagacaaagtccacgtcacctaccgaacgtctgaccctctg
caacccagagcacatctgaccgcggattatgtgattgtggccaccacagccaaggctgcc
cggctcctccgtttccagcctcctctctctcttggtaaggaagatgcactgcgatccgtc
cactacaacagcgccaccaaagtgatcctggcctgcacacagcgtttctgggagcgtgaa
ggcatcttttcgggcaaatccatcactgaccggccttcccgcttcatcttctaccccaac
catatcttccccaatggcacaggggtcatcctggcctcctatacactggatgatgattcc
tctttcttcgctgccatggaccatgcccaggtggtcaacattgtcctggatgatctggct
gaagtccatgacctccccaaggaggagctgagggccatgtgcccctactccaaggtcaag
cactggagtcaggacccctattccatgggaggttttgcttccttcactccctaccaatat
gtggactatgcccaggaacttttcaagtccgaagggcgggtctactttgcgggtgagcac
acagccctgcctcatggctggattgatactgccatcaagtcagggctcagggcagcacag
agcatccaagaggctgtgggcctggctttgaaaaagggccccagagacccaaaggaaccc
cactccaaaatggagctatag

DBGET integrated database retrieval system