KEGG   Sus scrofa (pig): 100525138Help
Entry
100525138         CDS       T01009                                 

Gene name
STRA8
Definition
(RefSeq) stimulated by retinoic acid gene 8 protein homolog
Organism
ssc  Sus scrofa (pig)
SSDB OrthologParalogGFIT
Motif
Pfam: Radial_spoke Na_trans_assoc CENP-B_dimeris FAM176 RNA_pol_3_Rpc31 DUF4746 NOA36
Motif
Other DBs
NCBI-GeneID: 100525138
NCBI-ProteinID: NP_001272899
Ensembl: ENSSSCG00000016533
UniProt: M9PAR4
Position
18
AA seq 366 aa AA seqDB search
MATSGEGSNPSGRAMPRPLAQLKVLEPRVARRRLSQARHRATLAGLFSNLRKAVYFHSDL
TASKWQVLNRAKAHIQELEQTLDNLLKLKESFNLEDGNANSLEEAKREYASMYSRNPSLV
SNKIYRKGSDTWCPIEAAGKDPDEEEEDEEEEEEDEEEEEEEEEKKVELLHSPVTLLPDL
MEFERYLNFYKQTMDLLIGNGIVSSQGVTLPIVSAAISHLWQTLSEERKASLLQAWVQKH
SGLPGLAEACPERAGAEGSVKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKSEAPS
TSSPSSVLAICNPEKPEEKFQLYMQIIDFFKGLCCVNTQLKQEPDLPVDDEIMRLRCMET
FDDEDL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctctggagaagggagcaaccccagcggcagagctatgccccggcccctggca
cagctgaaggtgcttgagcctcgggtggcccgcagacgcctgtcccaggcccgccaccga
gccaccctggcagggctcttcagcaacctcaggaaagccgtttactttcactctgacctc
acagcctcaaagtggcaggttttgaatagggcgaaggctcacattcaggaactagaacaa
accctggataatctgctgaagctgaaagaatccttcaacctggaggatgggaatgcaaac
agcttagaggaggccaagagagaatatgccagcatgtactccagaaaccccagtctggta
tcaaataaaatttataggaaaggctctgacacctggtgcccaattgaggcagctgggaag
gaccctgacgaggaagaagaggacgaggaagaagaagaggaggacgaggaggaggaagag
gaggaagaggagaaaaaagtggagctcctacactccccggtcaccttgttgccagacctc
atggaatttgaacggtacctcaacttctacaagcagacgatggaccttctgatcgggaac
ggaatcgtctcctcgcagggggtgacgctccccatcgtgtctgcagccatctcccacctg
tggcagaccctctctgaggagaggaaggccagcctcttgcaggcttgggtgcagaagcac
agtggcctcccaggcctcgcggaggcctgtccggagcgggccggtgccgagggcagcgtc
aaggacagcggagtcgacagccagggggccagctgctcactggtatccacccccgaggag
atcctttttgaagatgcctttgatgtggcaagtttcctggacaaaagtgaggctccaagt
acatctagccccagttccgtgctggccatctgcaacccagaaaagcccgaggagaagttt
cagctctacatgcagatcatcgatttttttaaaggcctttgctgtgttaacacgcagtta
aaacaggaaccggaccttcccgttgatgatgagataatgaggttgaggtgcatggagaca
tttgacgacgaagatctgtag

DBGET integrated database retrieval system